KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4339276
Entry
4339276           CDS       T01015                                 
Name
(RefSeq) general transcription factor IIF subunit 2
  KO
K03139  transcription initiation factor TFIIF subunit beta [EC:5.6.2.-]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03022  Basal transcription factors
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    4339276
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:osa03021]
    4339276
Enzymes [BR:osa01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.-
     4339276
Transcription machinery [BR:osa03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIF
     4339276
SSDB
Motif
Pfam: TFIIF_beta TFIIF_beta_N Tau95
Other DBs
NCBI-GeneID: 4339276
NCBI-ProteinID: XP_015638167
UniProt: B9FL24 Q6L4V9
LinkDB
Position
5:complement(25260639..25263758)
AA seq 259 aa
MGEEAKYLETARAERSVWLMKCPPVVSHAWQGAVSSSDAAGSNPNPVVAKVVLSLDLLRS
EEPSLQFKMEMAQTNTGNTPKSYSLNMSKDFVPMCVFSESNQGKLSCEGKVEHKFDMKPH
SDNLVNYGKLCRERTQKSMIKTRKVQVIEDHRMSLIPLPGMVGLIPSGSKEKKKQTPTKP
SDAKRIRRDRRELENIIFKLFERQPNWALKALVQETDQPEQFLKEILNDLCFYNKRGPNQ
GTHELKPEYKKSTGDTDAS
NT seq 780 nt   +upstreamnt  +downstreamnt
atgggcgaggaggccaagtacctcgagacggcgcgggccgagcgctccgtgtggctgatg
aagtgccccccggtcgtctcgcacgcctggcagggcgccgtgtcctcctccgacgccgcc
ggctccaaccctaaccccgtcgtcgccaaggtcgtcctctcccttgacctcctccgctcc
gaggagccctccctccagttcaagatggagatggctcaaactaacactggcaatacacca
aagagttactccttgaatatgtccaaggattttgtaccaatgtgtgttttctctgagtct
aaccaagggaaactttcatgtgaaggaaaagtcgagcataaatttgacatgaagcctcac
agtgataatttggtgaactatggaaagttatgccgtgaaaggacacaaaagtccatgatc
aaaactagaaaagtgcaggtaattgaggatcacagaatgagcctgataccgttgcctggc
atggttggtctcataccttctggttctaaggagaagaagaagcaaacaccaaccaaacca
tctgatgcaaaaagaatacgtagggatcgcagggaactggaaaatattatattcaagctt
tttgaaagacagcccaattgggcactaaaggcgctggtgcaagaaactgaccagccagag
caattcctgaaggagattctgaatgatctgtgtttttacaacaaacgaggaccaaaccag
ggaacgcatgagctcaagcctgagtacaagaaatctacaggggacactgatgcttcttga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9270266
Entry
9270266           CDS       T01015                                 
Name
(RefSeq) transcription initiation factor IIF subunit beta isoform X1
  KO
K03139  transcription initiation factor TFIIF subunit beta [EC:5.6.2.-]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03022  Basal transcription factors
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    9270266
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:osa03021]
    9270266
Enzymes [BR:osa01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.-
     9270266
Transcription machinery [BR:osa03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIF
     9270266
SSDB
Motif
Pfam: TFIIF_beta TFIIF_beta_N Tau95
Other DBs
NCBI-GeneID: 9270266
NCBI-ProteinID: XP_015629827
UniProt: Q5N8X8
LinkDB
Position
1:complement(32598083..32601874)
AA seq 277 aa
MAEEAKNLETARADRSVWLMKCPTVVSRAWQEAATAAASSSSSSDAAAGANSNSNANPNP
VVAKVIVSLDPLRSEDQQLQFKMEMAQTGNGNTPKSYSLNMFKDFVPMCVFSESNQGKLS
CEGKVGHKFDMEPHSDNLVNYGKLCRERTQKSMIKNRKLMVLANDNGMSMRPLPGLVGLM
SSGPKQKEKKPLPVKPSDMKRTRRDRRELENILFKLFERQPNWSLKNLMQETDQPEQFLK
EILNDLCFYNKRGPNQGTHELKPEYKKSTEDADATAT
NT seq 834 nt   +upstreamnt  +downstreamnt
atggcggaggaggcgaagaatctggagacggcccgggccgaccgctccgtgtggctcatg
aagtgcccgaccgtcgtctcccgcgcctggcaggaggccgccaccgccgccgcctcctcc
tcctcctcctcggacgccgccgctggcgccaactccaactccaacgcgaaccctaacccc
gtcgtcgccaaggtcatcgtctccctcgacccgctccgctccgaagatcagcagctccag
ttcaagatggagatggctcaaacaggcaatggcaatacaccaaagagttactccttgaac
atgttcaaggattttgtgccaatgtgtgtcttttctgaatccaaccaagggaagctttca
tgcgaagggaaagtcgggcacaaatttgacatggaaccgcacagcgataatcttgtgaac
tatgggaagttatgtcgtgagaggactcaaaaatctatgattaaaaatagaaaattgatg
gtacttgcgaatgacaatggaatgagcatgaggccgttgcctggcttggtgggtctgatg
tcttctggtccaaaacagaaggagaagaagccactaccagtaaaaccatcagacatgaaa
agaacgagaagggatcgcagggaactggaaaatatcttattcaagctttttgagaggcag
ccgaattggtctcttaagaatctcatgcaagaaactgatcaaccagagcaattcttgaag
gagatattgaatgatctgtgtttctacaacaaaaggggtccaaatcaagggacgcatgaa
cttaagcctgaatacaagaaatctacagaggacgctgatgctactgctacttag

DBGET integrated database retrieval system