KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4339549
Entry
4339549           CDS       T01015                                 
Name
(RefSeq) syntaxin-71
  KO
K08506  syntaxin of plants SYP7
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04130  SNARE interactions in vesicular transport
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    4339549
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4339549
Membrane trafficking [BR:osa04131]
 SNARE
  SNAP-25[C] (Qc)
   Syp7
    4339549
SSDB
Motif
Pfam: SNARE Ran-binding TTRAP DUF5089
Other DBs
NCBI-GeneID: 4339549
NCBI-ProteinID: XP_015639751
UniProt: A0A0P0WQ70
LinkDB
Position
5:27530247..27533768
AA seq 268 aa
MSVIDILTRVDSICKKYDKYDVERLNGANVAGEDPFARLYGSIDADINECVEKAEAAKQE
KNRATVVALNAEIRRTKAKLVEEDLPKLQRLALKKVKGLTKEELATRSDLVAALPDRIQS
IPDGSSSAKKNGTWGASGSRTGGAIKFDTSDGNFDDEYFKGTEESNQFRREYEMRKMKQD
EGLDIIGEGLETLKNMASDMNEELDRQVPLMDEMDEKVDRANTDLKNTNVRLKETVLQLR
SSRNFCIDIVLLCVILGIAAYLYNVLKK
NT seq 807 nt   +upstreamnt  +downstreamnt
atgagcgtgatcgacatcctcacgcgggtggactccatctgcaagaagtacgacaagtac
gacgtcgagaggctcaacggcgccaacgtcgccggcgaggaccccttcgcccgcctctac
ggctccatcgacgccgacatcaacgaatgcgtcgagaaagcggaggcggcgaagcaggag
aagaaccgcgccacggtggtcgcgctcaacgcggagatccggcgaaccaaggccaagctc
gtcgaggaggacctgcccaagctgcagcgcctcgcgctgaagaaggtcaaagggctcaca
aaagaggaactcgcgacccgtagtgatctggttgctgccttacccgatagaatacaatca
ataccagatggtagttcaagtgcaaagaaaaatgggacttggggcgcctcaggatcccgt
actggtggagccattaagtttgacacttctgatggcaactttgatgatgagtactttaag
ggaacagaagaatcaaatcagtttcgtcgggaatatgagatgcgcaaaatgaaacaggat
gaaggtttggatattatcggtgaagggctggaaactctgaaaaacatggcatctgatatg
aatgaggaactggataggcaagttcccttgatggatgaaatggacgagaaggtggataga
gccaacacagatttgaagaataccaacgtcagactaaaagagaccgttcttcagctgaga
tctagtcgcaacttctgcattgatatcgtcctgctctgtgttattcttggtattgcggct
tatctttacaatgttctaaaaaagtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4346842
Entry
4346842           CDS       T01015                                 
Name
(RefSeq) syntaxin-71
  KO
K08506  syntaxin of plants SYP7
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04130  SNARE interactions in vesicular transport
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    4346842
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4346842
Membrane trafficking [BR:osa04131]
 SNARE
  SNAP-25[C] (Qc)
   Syp7
    4346842
SSDB
Motif
Pfam: SNARE DUF5089 Tmemb_18A V-SNARE_C TRAP-gamma PIG-S CbiA Fib_alpha Tropomyosin
Other DBs
NCBI-GeneID: 4346842
NCBI-ProteinID: XP_015611159
LinkDB
Position
9:11700472..11702782
AA seq 284 aa
MSMIDVLIRVDAICKKYDKYDADKHRNGAAGDPFSRLYAAVDADIDAAVERSERAATETN
RAAAVALNADVRRTKARLTEEVVKLRKLAAKKVKGLSPEEALRGDLVLALPHRIQSIPDG
GGGAADQYGGGNVRPGIKFDSSAENLDEAYFQTTEESEEFRREYEMRRTKQDEGLEFISE
GLDTLKSLAEDMNEELNRQMPMMDEIDNKVDKSNEDLRKTNVRLKETVNQFRSTRNFMID
LILICIILGIAAYLYEQHTQSMNLTGSVITCSGITCSKIPGVND
NT seq 855 nt   +upstreamnt  +downstreamnt
atgagcatgatcgacgtgctgatccgggtggacgccatctgcaagaagtacgacaagtac
gacgccgacaagcaccgcaatggcgccgccggcgacccgttctcgcggctgtacgccgcc
gtcgacgccgacatcgacgccgccgtcgagagatccgagagggccgcgacggagacgaac
cgggcggcggcggtggcgctcaacgccgacgtgcggcgcaccaaggcgcggctcacggag
gaggtcgtcaagctccggaagctcgccgccaagaaggtgaaagggctctcgccggaggag
gcgctgcggggcgacctggtcttggcattgccgcataggatccagtccatccctgacggc
ggcggtggcgcggcggatcagtacggcggcgggaatgtccggccggggatcaagttcgat
tcttcagctgaaaatttggacgaggcgtacttccaaaccaccgaagaatcggaggagttc
agaagagagtacgaaatgcggcgaaccaaacaggatgaagggctggagttcatctctgaa
ggtttggacacactgaaaagcctggcagaggacatgaacgaggaactgaacaggcagatg
cctatgatggatgagattgacaacaaggtggataaatctaatgaagacctcagaaagact
aatgtcaggctaaaagaaacggtcaaccagtttcgatcgaccaggaacttcatgattgat
cttatcttgatttgcatcattcttggcattgctgcctacctctacgagcaacatactcaa
tcaatgaatctcactggttccgtcatcacctgttcaggaataacatgttccaagattcca
ggagtaaatgattaa

DBGET integrated database retrieval system