KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4339585
Entry
4339585           CDS       T01015                                 
Name
(RefSeq) phenylalanine--tRNA ligase beta subunit, cytoplasmic
  KO
K01890  phenylalanyl-tRNA synthetase beta chain [EC:6.1.1.20]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    4339585
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:osa01007]
    4339585
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:osa03016]
    4339585
Enzymes [BR:osa01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.20  phenylalanine---tRNA ligase
     4339585
Amino acid related enzymes [BR:osa01007]
 Aminoacyl-tRNA synthetase
  Class II (U)
   4339585
Transfer RNA biogenesis [BR:osa03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    4339585
 Prokaryotic type
    4339585
SSDB
Motif
Pfam: tRNA_synthFbeta PhetRS_B1 B3_4 B5 tRNA-synt_2d EAD7 DUF2740
Other DBs
NCBI-GeneID: 4339585
NCBI-ProteinID: XP_015640680
UniProt: Q0DG12 Q6AT40
LinkDB
Position
5:27800931..27807428
AA seq 596 aa
MPTVSVGRDRFFVALGRTYTQEEFEVLCFEFGIELDDVTTEKAIIRKEKHLEDDDGEVDG
DDDEVIYKIEVAANRYDLLCLEGLARALRIFTGTEATPMYKISCIPRDSMLLMHVKPQTS
QIRPYVVCAVLRGVTFDEARYNSFIDLQDKLHQNICRKRTLVAIGTHDLDTLKGPFSYEA
LPPQEINFVPLKQEESFRADKLMEFYKSDMKLKKFLHIIENSPVYPVIYDSNRTVLSLPP
IINGAHSAITLKTRNVFIECTATDLTKAKIVLNTMVTMFSEYCENKFEVEPVEVVSHDGS
KTIYPDLSCYKMEVSLSEVVGPIGISLDETKVISLLNKMQLQAESCPSKGEPRISVSVPP
TRSDILHARDLVEDVAIAYGYNNVPKSKPKCMTIGGRQPLNRFSDKLRAEVARAGYMEVL
TFTLCSREENFDMLNRTQDVNKAVIIANPRTSEFEVVRTSLMSCLLKTLKHNIDHPRPIK
IFEVGDVVTLDGSRDVGASNNRRLAALYCNKQSGFEEIMGLVDRIVNVVRAPHIKFGQNY
YVPTNEPEFFPKRQCKIVMSDGKQIGYLGIVHAEVLRKFGIPDPCTFVEIDVEALL
NT seq 1791 nt   +upstreamnt  +downstreamnt
atgccgacggtgagcgtcggccgggaccgcttcttcgtcgccctcggaaggacatacacg
caggaggagttcgaggtgctctgcttcgagttcggcatcgagctcgatgacgtgaccacg
gagaaggccatcatccggaaggagaagcacctggaggatgatgacggcgaggtggatggt
gatgacgacgaggtcatctacaagatcgaggtcgccgccaataggtatgatttgttatgt
cttgaaggattggcaagggccctccgcattttcactgggactgaagcgacccctatgtac
aaaatttcttgcatccctcgcgattcaatgcttctgatgcatgttaaacctcagacttca
caaataaggccctatgtggtctgtgctgtccttagaggggtaactttcgatgaagcaaga
tataacagcttcatcgatcttcaagacaaactccatcaaaatatttgcaggaagagaact
ctggtggccataggtacccacgatcttgacactctgaaaggacccttttcatatgaggct
ctaccaccacaagagatcaactttgtcccattaaagcaggaggaaagcttcagggctgat
aaactgatggaattctataaatcagacatgaagttgaagaagttcctgcatataattgag
aattcgccagtatacccagttatttatgatagcaacaggaccgtattgtctttaccacca
atcatcaatggtgcacattctgctatcactctgaagacaaggaatgtgtttattgagtgt
accgctactgaccttacaaaagcaaagattgttctcaatacaatggtcacaatgttctct
gagtactgcgaaaacaagtttgaagtggaaccagttgaagttgtgtcacatgatggaagc
aaaaccatttaccctgacctttcatgctataaaatggaggtctcactatctgaggttgtt
ggacccattggcatctccctagatgagacaaaggttatttcccttctgaacaaaatgcag
ttgcaagctgaaagttgtccatcaaaaggggaaccacgtatttcagtttctgtccctcca
acaagaagtgacattctgcatgctcgtgatttggtggaggatgttgctatagcttatggt
tacaacaatgtgccaaaatcaaagccaaagtgtatgacaataggaggaaggcaaccatta
aaccgtttctctgataaacttcgtgctgaggttgcaagagctggttatatggaggtgctc
acatttaccttgtgttcacgtgaagaaaactttgacatgttaaataggacacaggatgta
aataaagcagttattattgcgaatccacgcacttctgaatttgaggtggttcgaaccagt
ctgatgtcatgtttattgaaaactttgaagcataacatagaccatccaagacccataaag
atatttgaagttggtgatgtagtgacattggatgggtcacgtgatgttggtgcttctaat
aatcgtcgactcgcagctttgtactgtaataagcagtctgggtttgaggaaattatgggt
ttggtagatagaatcgtgaatgttgtgagagctccccacatcaaatttggccagaattac
tatgttcctacaaatgaacctgaattctttccgaaaagacaatgcaaaattgttatgagt
gatggaaagcagattggctacttaggaattgtgcatgccgaggtcctaaggaaattcggc
attccagacccctgcactttcgttgagattgacgttgaggctttgttatag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4348566
Entry
4348566           CDS       T01015                                 
Name
(RefSeq) phenylalanine--tRNA ligase alpha subunit, cytoplasmic
  KO
K01889  phenylalanyl-tRNA synthetase alpha chain [EC:6.1.1.20]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    4348566
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:osa01007]
    4348566
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:osa03016]
    4348566
Enzymes [BR:osa01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.20  phenylalanine---tRNA ligase
     4348566
Amino acid related enzymes [BR:osa01007]
 Aminoacyl-tRNA synthetase
  Class II (U)
   4348566
Transfer RNA biogenesis [BR:osa03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    4348566
 Prokaryotic type
    4348566
SSDB
Motif
Pfam: tRNA-synt_2d PheRS_DBD3 PheRS_DBD1 tRNA-synt_2 tRNA_synthFbeta PheRS_DBD2 tRNA-synt_2b DUF465
Other DBs
NCBI-GeneID: 4348566
NCBI-ProteinID: XP_015612723
UniProt: Q338I8 A0A8J8XCG8
LinkDB
Position
10:complement(13537552..13542435)
AA seq 493 aa
MADVEACLLAHLNSGGEVPDSRSYASSLRVTHDELEAVIKSLSAFRIVDTTDITKETWVL
TDEAKGYVAGGSPEAQLVAAIPPEGASKDVLREKLGSVFDIGMKTAAKNKWIGFEKGNKD
LVLRKVNTIKDDLQEQLKSLESGEVLSDKVIDDLKRRKLITKEKSIWYALKKGPQFVAKR
KKLATDVTQEHLRSGDWKDLEFKDYNFGAQGQPIAIGYVQPLLEVREEIQNIFLQMGFTE
MPTNNYVESSFWNFDALFQPQQHPARDSHDTFFLEAPAATKQLPEDYLEKVKEVHQRGGY
GSKGYGYDWKRDEAEKNLLRTHTTAVSTRMLYKLAQEKPFAPKRYYSIDRVFRNEAVDRT
HLAEFHQIEGLICDYGLTLGDLIGVLEDFFSSLGMSKLRFKPAYNPYTEPSMEIFSYHEG
LKKWVEVGNSGMFRPEMLLPMGLPEGVNVIAWGLSLERPTMILYGIDNIRDLFGPKVDFN
LIKSNPLCRLGLQ
NT seq 1482 nt   +upstreamnt  +downstreamnt
atggcggatgtggaggcctgcctcctcgcccacctcaactccggcggcgaggtgccggac
tcccgctcctacgcctcctccctccgcgtcacccacgacgagctcgaggccgtcatcaag
agcctctcggctttccgcattgtcgacaccacggacatcaccaaggagacgtgggtgcta
accgatgaagctaaggggtacgtcgcgggtggctcccccgaagcgcagctcgtcgctgca
atcccaccggagggtgcctccaaggacgtgctcagggagaaattgggatctgtctttgac
atcggcatgaagacggctgcgaagaacaagtggattggttttgagaaagggaataaggac
ttggtgttgagaaaggttaacaccatcaaggatgacttgcaagagcaactgaaaagtcta
gagagtggagaggttctttctgacaaggtgattgatgatttgaaaagaagaaagcttatc
acaaaagagaaatcaatttggtatgccctaaagaaaggaccccagtttgtcgcgaagagg
aaaaaactggcaactgatgtgacacaagagcatctcagaagtggtgattggaaggatctt
gaattcaaagactataactttggagcccagggacaacctattgccattggttatgtgcaa
cctttgttggaggtgcgagaggaaatccagaacatctttcttcagatggggttcactgag
atgccaactaacaattacgttgagagcagcttctggaacttcgatgcactgttccagccc
caacagcatcctgctcgggattcacacgatacattttttcttgaagcccctgccgctaca
aaacaattgcctgaagattatcttgagaaagtaaaggaagttcatcaacgtggtggttat
ggctccaagggatatggctatgactggaaacgggatgaagcagagaaaaacctgcttcgt
acccacactacagcagtttcaacaaggatgctatacaagctagcacaagagaaacctttt
gcccctaagaggtactactccattgatcgtgttttccgcaatgaagctgtggaccggact
catcttgcggaattccaccagattgaaggtctcatttgtgattatggtttgacgctgggt
gatctgattggtgtattggaggatttcttctcgagtctaggcatgtcaaagctgcgtttc
aagcctgcctacaatccatacaccgagccgagcatggaaattttcagttaccatgaaggt
ttgaagaaatgggtggaagttggtaactctggcatgttcagacctgaaatgttacttccc
atgggactgccagagggtgttaatgttattgcatggggtctttcactagaaaggccaaca
atgattctttacggcatcgacaacattcgagacctctttggaccaaaggttgatttcaac
ctcatcaagagcaaccctctctgccgcttgggactgcagtaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4352408
Entry
4352408           CDS       T01015                                 
Name
(RefSeq) phenylalanine--tRNA ligase, chloroplastic/mitochondrial isoform X1
  KO
K01889  phenylalanyl-tRNA synthetase alpha chain [EC:6.1.1.20]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    4352408
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:osa01007]
    4352408
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:osa03016]
    4352408
Enzymes [BR:osa01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.20  phenylalanine---tRNA ligase
     4352408
Amino acid related enzymes [BR:osa01007]
 Aminoacyl-tRNA synthetase
  Class II (U)
   4352408
Transfer RNA biogenesis [BR:osa03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    4352408
 Prokaryotic type
    4352408
SSDB
Motif
Pfam: tRNA-synt_2d FDX-ACB
Other DBs
NCBI-GeneID: 4352408
NCBI-ProteinID: XP_015620549
UniProt: Q2QPD4
LinkDB
Position
12:21220786..21225728
AA seq 448 aa
MRSLIRSASSRLLRARARAMATPSAARFSPSSNPARPPPPRLPLPRFLPPTPPQALLRAR
PLRTSAAVAAAAAVVEVGGVKIAREDVVKEEDPTNNVPDTIYSKIGLQLHRRDNHPLGIL
KNTIYDYFDKNFSGNFNKFDDLCPLVSIKQNFDDVLVPADHVSRSYNDTYYVDAQTVLRC
HTSAHQAELLRDGHTHFLVTGDVYRRDSIDSTHYPCFHQMEGFRVFTPDEWSDSGMDGTA
YAAADLKKTLEGLAKHLFGAVEMRWVDTYFPFTNPSFELEIYFQDDWLEVLGCGVTEQEI
LKNNGRIDNVAWAFGLGLERLAMVLFDIPDIRLFWSNDKRFTSQFSEGKLGVKFKPFSKF
PPCYKDMSFWINEEFTENNLCEVVRGIAGDLVEEVKLIDNFTNKKGMTSHCYRIAYRSME
RSLTDEEINDMQWNVREEVQNKLKVELR
NT seq 1347 nt   +upstreamnt  +downstreamnt
atgcgctcgcttatccgaagcgcctcctcccgcctcctccgcgctcgcgcccgcgccatg
gccacgccctccgccgcgcgcttctccccctcctccaaccccgcgcgccctcctcctcct
cgcctcccgctcccccgcttccttccgccgaccccgccgcaggcgctgctccgggcgagg
cctctccggacctcggctgccgttgccgcggccgcggccgtcgtggaggtgggcggcgtc
aagatcgcgcgggaggatgtcgtgaaggaggaggacccaacaaacaacgttccggacacg
atctactcaaagattggcctgcagctgcacaggagggataatcaccctctagggattctg
aagaacactatttacgactactttgacaagaatttctctgggaactttaacaagttcgat
gacctctgccctcttgtttctatcaagcagaattttgatgatgtcctggtccctgctgat
catgtgagtcggagttacaatgacacatactatgttgatgctcaaactgtcttgcggtgt
cataccagcgctcatcaagcagagctgctaagggatggacacacacatttccttgtaact
ggggatgtttatcgtagggattctattgattcaactcactatccttgcttccatcagatg
gagggcttccgtgtcttcactccagatgaatggtcagattctggcatggatgggacagca
tatgcagctgcagacctcaagaaaacactggaaggcttggcaaaacatctctttggtgct
gtggaaatgcgatgggttgacacatacttcccattcactaacccgtcctttgaactcgag
atatattttcaggatgattggttggaagttctgggatgtggagtcactgagcaggaaatt
ttgaaaaacaacggcaggatagataatgtggcatgggcctttggactaggtttggagcgc
ttagcaatggtcctgtttgatattccagatattcgactcttttggtcaaatgataagcga
ttcacatcccagttttcagaaggcaaacttggtgtcaagtttaagccattctcaaagttt
ccaccttgctacaaggatatgagtttttggatcaatgaagagtttacagagaacaattta
tgtgaggttgtcagaggaattgctggagatcttgtagaggaggtaaaactaattgacaat
ttcaccaacaagaaaggaatgacgagccattgctacaggatagcctataggtcaatggaa
cgttcacttaccgatgaggagatcaacgacatgcagtggaatgtcagagaagaggtgcaa
aataaactgaaagttgagttgagatga

DBGET integrated database retrieval system