KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4339642
Entry
4339642           CDS       T01015                                 
Name
(RefSeq) probable DNA-3-methyladenine glycosylase 2
  KO
K01247  DNA-3-methyladenine glycosylase II [EC:3.2.2.21]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    4339642
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:osa03400]
    4339642
Enzymes [BR:osa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.21  DNA-3-methyladenine glycosylase II
     4339642
DNA repair and recombination proteins [BR:osa03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     4339642
SSDB
Motif
Pfam: HhH-GPD
Other DBs
NCBI-GeneID: 4339642
NCBI-ProteinID: XP_015639469
UniProt: B9FI65 Q688W2
LinkDB
Position
5:complement(28250296..28256784)
AA seq 290 aa
MVKTRAAATPRPSGGGGGAGAADITAGKISFRSRKIVKSTPAKGKSVATTTTAVLSPPPL
SSPGELAAALSHLRTADPLLSEVISSTGAPAFISSPSRPAFHSLAHSILHQQLAPSAAAA
IYARFLALIPAAADPDAAVVNPAAVLALSAADLRAIGVSARKAAYLHDLAGRFAAGELSE
SAVAAMDEAALLAELTKVKGVGEWTVHMFMIFSLHRPDVLPSGDLGVRKGVQELYGLPAL
PKPEEMAALCERWRPYRSVGAWYMWRLMESKGAAAKKAKSNAIATLPSSC
NT seq 873 nt   +upstreamnt  +downstreamnt
atggtcaagaccagagcggcggcgactccccgcccctccggcggcggcggcggcgcaggc
gcagcggacatcaccgccggtaagatctccttccgctcccgcaagatcgtcaagagcaca
cccgccaaagggaaatccgtcgccacaacaacaacagccgtactatcgccaccgccgctg
tcctcgccgggggagctcgcggcggcgctctcgcacctccgcaccgcggacccgctcctc
tccgaggtcatctcctccaccggcgccccggccttcatctcgtccccttcccgccccgcc
ttccactccctcgcgcactccatcctccaccagcagctcgctccctccgccgccgccgcc
atctacgctcgcttcctcgcgctcatccccgccgccgctgatcccgatgccgcggtggtc
aaccccgctgcggtgctcgccctctccgccgccgacctccgcgccatcggcgtctccgcc
cgcaaggcggcctacctccacgacctcgccggcaggttcgcggccggggagctctcggag
tccgccgtggccgcaatggacgaggcggcgctcctcgcggagctcaccaaggtgaagggc
gtcggcgagtggacggtccacatgttcatgatcttctcgctgcaccgccccgatgtgctg
ccatccggcgacctcggcgtgcgcaagggcgtgcaggagctgtacgggctgccggcgctg
ccgaagccggaggagatggcggcgctgtgtgagcggtggaggccgtaccggtcggtgggc
gcgtggtacatgtggcgcctcatggagagcaagggcgccgcggccaagaaggcgaagagc
aatgccattgccactttgccatcgagttgctag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4339711
Entry
4339711           CDS       T01015                                 
Name
(RefSeq) probable DNA-3-methyladenine glycosylase 2
  KO
K01247  DNA-3-methyladenine glycosylase II [EC:3.2.2.21]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    4339711
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:osa03400]
    4339711
Enzymes [BR:osa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.21  DNA-3-methyladenine glycosylase II
     4339711
DNA repair and recombination proteins [BR:osa03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     4339711
SSDB
Motif
Pfam: HhH-GPD DUF6319
Other DBs
NCBI-GeneID: 4339711
NCBI-ProteinID: XP_015639556
UniProt: Q9XHW2
LinkDB
Position
5:28826583..28828001
AA seq 334 aa
MESPNPQQVNSMGDQSPLSPNLHPLSPSPSAAAAAAATPTPAAAAASSRSSRSKKPPHSS
DPNQSKKPRLTLTVPGRPLSADGEVAAAIQHLRAADPALATVIDAHDPPAFQCPHRPFHS
LVRSILYQQLAFKAAASVYSRFLSLLGGEHNVLPEAVLALTTQDLRQIGVSPRKASYLHD
LARKYASGILSDAAVVNMDDRSLAAMLTMVKGIGAWSVHMFMIFSLNRPDVLPAADLGVR
KGVQHLYGLDAVPRPSQMEKLCEQWRPYRSVGAWYMWRLIESKAPPPPPAIPVGPPALTE
HGDELMLQQQQHQQQQQQSVIQMIDPLQMLPGMG
NT seq 1005 nt   +upstreamnt  +downstreamnt
atggaatcacccaacccccaacaggtcaattccatgggcgaccaatcccccctctccccc
aacctccaccccctctccccgtcgccctccgccgccgccgccgccgccgccactcctacc
cccgcagccgccgccgcctcctcccgctcgtcgcgctccaagaagccgccgcactcctcc
gaccccaaccaatccaagaagccccggctgacgctgaccgtccccggccgccccctctcc
gccgacggcgaggtggccgcggccatccagcacctgcgcgccgccgacccggccctcgcc
accgtcatcgacgcccacgaccccccggccttccagtgcccgcaccgccccttccactcc
ctcgtccgatccatcctctaccagcagctcgccttcaaggccgccgcctccgtctactcc
cgcttcctctccctcctcggcggcgagcacaacgtcctccccgaggccgtcctcgccctc
accacccaggacctccgccagatcggggtctcccctcgcaaggcctcctacctccacgac
ctcgcccgcaagtatgcctccgggatcctctccgacgccgccgtcgtcaacatggacgac
cgctccctcgccgccatgctcaccatggtcaagggcattggcgcatggagcgtccacatg
ttcatgatcttctccctcaatcgccccgacgtgctccccgccgccgaccttggggtgcgc
aagggcgtgcagcatctctacggtctcgacgccgtgccccggccgtcgcagatggagaag
ctatgcgagcaatggcgcccttaccgctctgttggggcatggtacatgtggcggctcatc
gaatccaaggcgccgccgccgccgccggccatccctgtcgggccgcctgcactgactgaa
catggcgatgagctcatgctccagcagcagcagcatcagcaacagcagcaacagagtgtc
atccaaatgattgatcctcttcagatgctcccagggatgggttga

DBGET integrated database retrieval system