KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4339812
Entry
4339812           CDS       T01015                                 
Name
(RefSeq) UDP-glucose 4-epimerase 1
  KO
K01784  UDP-glucose 4-epimerase [EC:5.1.3.2]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00052  Galactose metabolism
osa00520  Amino sugar and nucleotide sugar metabolism
osa01100  Metabolic pathways
osa01250  Biosynthesis of nucleotide sugars
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    4339812
   00520 Amino sugar and nucleotide sugar metabolism
    4339812
Enzymes [BR:osa01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.2  UDP-glucose 4-epimerase
     4339812
SSDB
Motif
Pfam: GDP_Man_Dehyd Epimerase 3Beta_HSD Polysacc_synt_2 RmlD_sub_bind NAD_binding_10 adh_short KR NAD_binding_4 NmrA Sacchrp_dh_NADP DAO UDPG_MGDP_dh_N
Other DBs
NCBI-GeneID: 4339812
NCBI-ProteinID: XP_015640233
UniProt: Q8LNZ3
LinkDB
Position
5:29631963..29635768
AA seq 354 aa
MVSALLRTILVTGGAGYIGSHTVLQLLQLGFRVVVLDNLDNASELAILRVRELAGHNANN
LDFRKVDLRDKQALDQIFSSQRFEAVIHFAGLKAVGESVQKPLLYYDNNLIGTITLLQVM
AAHGCTKLVFSSSATVYGWPKEVPCTEESPLCAMNPYGRTKLVIEDMCRDLHASDPNWKI
ILLRYFNPVGAHPSGYIGEDPCGIPNNLMPFVQQVAVGRRPALTVYGTDYNTKDGTGVRD
YIHVVDLADGHIAALRKLYEDSDRIGCEVYNLGTGKGTSVLEMVAAFEKASGKKIPLVFA
GRRPGDAEIVYAQTAKAEKELKWKAKYGVEEMCRDLWNWASKNPYGYGSPDSSN
NT seq 1065 nt   +upstreamnt  +downstreamnt
atggtttcggccttgttgcggacgatcctggtgacgggcggcgccggctacatcggcagc
cacaccgtcctccagcttctccaactcggcttccgcgttgtcgtcctcgacaacctcgac
aacgcctccgagctcgccatcctccgcgtcagggaactcgccggacacaacgccaacaac
ctcgacttccgcaaggttgacctccgcgacaagcaagcgttggaccaaatcttctcctct
caaaggtttgaggctgtcatccattttgccgggctgaaagctgttggcgagagcgtgcag
aagcccctgctttactacgacaacaacctcatcggcaccatcactctcctgcaggtcatg
gccgcacatggctgcaccaagctggtgttctcatcatccgcaactgtctacgggtggccc
aaggaggtgccctgcactgaagaatccccactttgtgcaatgaacccctacggcagaaca
aagctggtaatcgaagacatgtgccgggatctgcatgcctcagacccaaactggaagatc
atactgctccgatacttcaaccctgttggagctcacccaagcgggtacattggtgaggac
ccctgcggcatcccaaacaacctcatgcccttcgtccagcaggtcgctgttggcaggagg
ccggcccttaccgtctatggaaccgactacaacaccaaggatggaactggggttcgtgac
tatatccatgttgttgatctagcggatggtcatatcgccgcgttaaggaagctctatgaa
gattctgatagaataggatgtgaggtgtacaatctgggcactggaaaggggacatctgtg
ctggaaatggttgcagcattcgagaaagcttctggaaagaaaatcccgcttgtatttgct
ggacgaaggcctggagatgccgagatcgtttacgctcaaactgccaaagctgagaaggaa
ctgaaatggaaggcaaaatacggggtagaggagatgtgcagggacctgtggaattgggcg
agcaagaacccctacgggtatggatcgccggacagtagcaactga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4345415
Entry
4345415           CDS       T01015                                 
Name
(RefSeq) UDP-glucose 4-epimerase 2
  KO
K01784  UDP-glucose 4-epimerase [EC:5.1.3.2]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00052  Galactose metabolism
osa00520  Amino sugar and nucleotide sugar metabolism
osa01100  Metabolic pathways
osa01250  Biosynthesis of nucleotide sugars
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    4345415
   00520 Amino sugar and nucleotide sugar metabolism
    4345415
Enzymes [BR:osa01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.2  UDP-glucose 4-epimerase
     4345415
SSDB
Motif
Pfam: GDP_Man_Dehyd Epimerase 3Beta_HSD Polysacc_synt_2 RmlD_sub_bind NAD_binding_10 KR adh_short NAD_binding_4
Other DBs
NCBI-GeneID: 4345415
NCBI-ProteinID: XP_015650590
UniProt: Q6ZDJ7
LinkDB
Position
8:complement(17570085..17576418)
AA seq 408 aa
MAVEKTVPGGVRTVLVTGGAGYIGSHAVLQLLLAGFRAVVVDNLNNSSELAVRRVAALAG
DHSRNLAFHKVDLRDKGALEKVFASTRFDAVVHFAGLKAVGESVQKPLLYYDNNVNGTVN
LLEVMSAHGCKKLVFSSSAAVYGSPKNSPCTEEFPLTPNNPYGKTKLVVEDICRDIYRTD
PEWKIILLRYFNPVGAHPSGYLGEDPCGIPNNLMPYVQQVAVGRRPALTILGNDYATRDG
TGVRDYIHVVDLADGHIAALQKLFESSSIGCEAYNLGTGKGTSVLEIVKAFEKASGKKIP
LIIGPRRPGDAEILFSLPAKAEKELNWKAKFGIDEMCRDQWNWASKNPYGYGSLDSTKQN
GHHSYGSIGSPKQNGHCTNGFSESTRHNGHNGYGLVDSAKHNGNGHFH
NT seq 1227 nt   +upstreamnt  +downstreamnt
atggcggtggagaagacggtgccgggcggggtgaggacggtgctggtgacgggcggggcg
gggtacatcggcagccacgccgtgctgcagctcctcctcgccggattccgcgccgtcgtc
gtcgacaacctcaacaactcctccgagctcgccgtccgccgcgtcgccgccctcgccggc
gaccactcccggaacctcgccttccacaaggttgacctccgtgacaagggagcactggaa
aaggtttttgcttcaacaagattcgatgctgtagttcactttgctgggctaaaagctgtg
ggcgaaagtgtgcagaagccattgctttattacgacaacaatgttaatggaacagtaaat
cttctggaagttatgtctgcccatggatgtaagaagttggtgttctcatcatcagctgca
gtttatggatcaccgaagaactcaccctgcacagaagagtttcctctcactccaaacaat
ccatatggcaaaacaaagcttgttgttgaagatatttgccgtgatatctaccgtacagat
cctgaatggaagattattctacttaggtacttcaatccagttggggctcatcctagcgga
taccttggggaagatccatgtggcattcccaacaatcttatgccttatgttcagcaagtt
gctgttggcaggaggccagctctgacaatactaggaaatgattatgcaaccagagatggt
accggggtccgagattacatccatgtggttgaccttgctgatggacatattgcggcattg
cagaaactctttgagagctccagcatagggtgtgaagcatacaaccttggaactggtaaa
ggtacctctgtgctggagatagtcaaggcatttgagaaggcttctgggaagaaaattcct
ctgattattggcccaagacgccctggtgatgcggagattctattttcattacctgctaaa
gcagagaaggaactcaactggaaagcgaaatttggcatcgatgaaatgtgtagggatcaa
tggaactgggctagcaagaacccttatggatacgggtcacttgactccaccaagcagaac
ggacaccactcgtacggatcaattggctctcccaagcagaatggccactgcacaaatgga
ttttctgaatccactaggcataatggtcacaacggatatggactggtcgactctgccaag
cataacggcaacggccacttccactga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4346723
Entry
4346723           CDS       T01015                                 
Name
(RefSeq) UDP-glucose 4-epimerase 4
  KO
K01784  UDP-glucose 4-epimerase [EC:5.1.3.2]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00052  Galactose metabolism
osa00520  Amino sugar and nucleotide sugar metabolism
osa01100  Metabolic pathways
osa01250  Biosynthesis of nucleotide sugars
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    4346723
   00520 Amino sugar and nucleotide sugar metabolism
    4346723
Enzymes [BR:osa01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.2  UDP-glucose 4-epimerase
     4346723
SSDB
Motif
Pfam: GDP_Man_Dehyd Epimerase 3Beta_HSD RmlD_sub_bind Polysacc_synt_2 NAD_binding_10 KR NAD_binding_4 adh_short adh_short_C2 NmrA
Other DBs
NCBI-GeneID: 4346723
NCBI-ProteinID: XP_015611994
UniProt: Q6K2E1
LinkDB
Position
9:complement(9437661..9442735)
AA seq 369 aa
MAGGEVVAVAAAAAGTSRTVLVTGGAGYIGSHTVLQLLAAGFRVVVADSLGNSSELAVRR
VAALAGDKARNLSLHKVDIRDKGGLEKVFSSTRFDAVVHFAGLKAVGESVQKPLLYYDHN
VAGTIILLEVMAAHGCKKLVFSSSAAVYGSPKNSPCTEEFPLTPHNPYGRTKLIAEEICR
DIYHSDSEWSIILLRYFNPVGAHPSGYLGEDPCGIPNNLMPFVQQVAVGRRPSLTIFGND
YATKDGTGVRDYIHVVDLAEGHIAALRKLFESSIGCQAYNLGTGKGTSVLEIVNAFEKVS
GKKIPLVIGPRRPGDAEILFSSAAKAEREFKWKAKYGIEEMCRDQWNWASKNPFGYASPD
STKQNGHSH
NT seq 1110 nt   +upstreamnt  +downstreamnt
atggcggggggcgaggtggtggcggtggcggcggcggcggcggggacgagcaggacggtg
ctggtgacgggaggggccgggtacatcgggagccacaccgtgctgcagctgctcgccgcg
gggttccgcgtcgtcgtcgccgacagcctcgggaactcctccgagctcgccgtccgccgc
gtcgccgcgctcgccggggacaaggcgcggaacctctccttacacaaggttgatattcgt
gataagggtggactggaaaaggttttttcttcgacaagatttgatgctgtcgttcatttt
gctggtctgaaagctgtgggtgaaagtgtgcagaagccattgctttattatgaccataat
gttgctgggacaataattcttctagaagttatggcagcccatggatgtaaaaagttggtg
ttttcatcgtcagctgcagtttatggatcacctaaaaactcaccctgcacagaagagttt
cctctcactccacacaatccatatggcagaaccaagctcatagcagaggagatttgccgt
gatatataccattcagattctgaatggagcataattttacttaggtacttcaatcctgtt
ggagctcatcccagtggataccttggtgaagacccatgtggaattcctaacaacctcatg
cccttcgtccagcaagttgctgtcgggaggagaccgtcacttacaatatttggaaatgac
tatgcaacaaaagatgggacaggggtacgtgattatattcatgtagttgatcttgctgag
gggcatattgctgcactacggaagctgtttgaaagctcaataggatgtcaagcatacaac
cttggaacaggaaagggaacatcagtgttggaaatagttaatgcatttgagaaagtttct
ggaaagaaaatacctttggttattggtccacgacgccctggtgatgctgagattctcttt
tcgtcagctgctaaagcagagagagaattcaagtggaaggcaaaatatggcatcgaagaa
atgtgcagagaccaatggaactgggcgagcaagaatcctttcgggtacgcctcgcccgac
tccaccaagcagaatggtcattcacactga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4347638
Entry
4347638           CDS       T01015                                 
Name
(RefSeq) UDP-glucose 4-epimerase 3
  KO
K01784  UDP-glucose 4-epimerase [EC:5.1.3.2]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00052  Galactose metabolism
osa00520  Amino sugar and nucleotide sugar metabolism
osa01100  Metabolic pathways
osa01250  Biosynthesis of nucleotide sugars
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    4347638
   00520 Amino sugar and nucleotide sugar metabolism
    4347638
Enzymes [BR:osa01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.2  UDP-glucose 4-epimerase
     4347638
SSDB
Motif
Pfam: GDP_Man_Dehyd Epimerase 3Beta_HSD Polysacc_synt_2 RmlD_sub_bind NAD_binding_10 NAD_binding_4 adh_short KR NmrA UDPG_MGDP_dh_N NAD_binding_7
Other DBs
NCBI-GeneID: 4347638
NCBI-ProteinID: XP_015610723
UniProt: Q652A8
LinkDB
Position
9:complement(20600615..20603053)
AA seq 373 aa
MVSGGGVAAENGEMVGNGEGRKGAGASVLVTGGAGYIGTHTVLRLLEKGFAVTVVDNFHN
SVPEALDRVRLIAGAALSARLDFIAGDLKSKDDMEKVFAAKRYDAVIHFAGLKAVGESVA
HPQMYYENNVAGTMNLYSAMTKYGCKKIVFSSSATVYGQPEKTPCVEDSKLSALNPYGTT
KLVLENYFRQVQAADPEMRVILLRYFNPIGAHRSGDIGEDPRGIPNNLLPYIQQVAVGRR
PELNVYGVDYPTRDGTAIRDYIHVVDLADGHIAALEKLFATPDIGCVAYNLGTGCGTTVL
EVVKAFEEASGKKIPIKICPRRPGDCTEVYASTDKAKKELGWSARFGIEDMCRDQWNWAK
KNPYGYSANAEQN
NT seq 1122 nt   +upstreamnt  +downstreamnt
atggtgagcggcggaggagtagcggcggagaacggcgagatggtggggaacggggagggg
aggaagggtgcgggggcgagcgtgctggtgacggggggagcggggtacatcgggacgcac
acggtgctgcggctgctggagaaggggttcgcggtcaccgtcgtcgacaacttccacaac
tccgtcccggaggcgctcgaccgcgtccgcctcatcgccggcgccgccctctccgcccgc
ctcgacttcatcgccggggatctcaagagcaaggacgacatggagaaggtgttcgccgcc
aagaggtatgacgccgtgatccacttcgccgggctgaaggcggtgggggagagcgtcgcg
cacccgcagatgtactacgagaacaacgtcgccggcaccatgaacctctactccgccatg
accaagtacggctgcaagaagatagtgttctcgtcgtcggcgacggtgtacggccagccg
gagaagaccccctgcgtcgaggattccaagctgagcgctctcaacccatacggcaccacc
aagctcgtcctggagaactacttccggcaggtgcaggccgccgacccggagatgagggtg
atcctgctcaggtacttcaaccccatcggcgctcaccggagcggcgacatcggggaggac
cccaggggcatccccaacaaccttcttccgtacatccagcaggtcgccgtcggccgccgc
cccgagctcaacgtctacggcgtcgactacccaaccagggacggcaccgcgatcagggat
tacatacatgtagtggaccttgccgatggccacattgccgcactggagaagctcttcgct
actcctgacattggttgtgtggcttacaatctaggaacagggtgtggaacaacggtgctc
gaggtggtgaaggcgttcgaggaggcgtccggaaagaaaattcctatcaagatttgcccc
agaagacctggagattgcactgaggtttacgcttccactgacaaggccaagaaggagctc
ggatggagtgctcggtttggaatagaggacatgtgcagggaccagtggaattgggccaag
aagaatccgtacggatacagcgccaatgctgagcagaattag

DBGET integrated database retrieval system