KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4339866
Entry
4339866           CDS       T01015                                 
Name
(RefSeq) protein CWC15 homolog
  KO
K12863  protein CWC15
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    4339866
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:osa03041]
    4339866
Spliceosome [BR:osa03041]
 Complex B
  Other components
   Prp19 complex
    4339866
 Complex C
   Prp19-CDC5 complex
    4339866
SSDB
Motif
Pfam: Cwf_Cwc_15 MFAP1
Other DBs
NCBI-GeneID: 4339866
NCBI-ProteinID: XP_015644216
UniProt: Q0DF97
LinkDB
Position
6:complement(413443..416052)
AA seq 230 aa
MTTAARPTWAPAKGGNEQGGTRIFGPSQKYSSRDLAAHTTLKPRKEGQHTQEELQKRNLR
DELEERERKHYSSKDKSYAEERDRRKSTSLLLEGSRREAEDKIVPREIDADDSDVEPRSD
DESDEDDDDDDDTEALMAELERIKKERAEENLRKERQQAEEEAKMKEAELMRGNPLININ
NAGSFNVKRRWDDDVVFKNQARGETKTPKRFINDTIRSDFHRKFLQRYMK
NT seq 693 nt   +upstreamnt  +downstreamnt
atgaccacggcggcgcggccgacctgggctccggccaagggcggcaacgagcagggcggc
acccgcatcttcgggccctcgcagaagtactcctcccgcgacctcgccgcccacaccacc
ctcaagcccaggaaagaaggacaacatacccaagaagagttacagaagaggaatctcagg
gacgaacttgaggagcgtgagaggaagcactactcgtcaaaggacaagtcctatgctgag
gagagagataggcggaaaagcacaagcctactcctagaaggttcaaggagagaggctgag
gataagatagttcctagagaaatcgatgcagatgattctgatgtggaacccagaagtgat
gatgaaagtgatgaggatgatgacgacgatgatgacactgaagctctaatggcagagctt
gaaagaatcaagaaagaaagagctgaagaaaaccttagaaaggaacgccaacaagcagaa
gaggaggctaagatgaaggaagctgaactgatgcggggaaaccccctgatcaatattaac
aacgccggatccttcaatgttaagagaaggtgggatgatgatgttgtattcaagaaccag
gctcgtggagagaccaagacaccgaaacgtttcatcaacgacactatcagaagtgatttc
caccgtaagtttctgcagaggtacatgaagtga

DBGET integrated database retrieval system