KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4339892
Entry
4339892           CDS       T01015                                 
Name
(RefSeq) 6-phosphogluconate dehydrogenase, decarboxylating 1
  KO
K00033  6-phosphogluconate dehydrogenase [EC:1.1.1.44 1.1.1.343]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00030  Pentose phosphate pathway
osa00480  Glutathione metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
Module
osa_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
osa_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    4339892
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    4339892
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.44  phosphogluconate dehydrogenase (NADP+-dependent, decarboxylating)
     4339892
    1.1.1.343  phosphogluconate dehydrogenase (NAD+-dependent, decarboxylating)
     4339892
SSDB
Motif
Pfam: 6PGD NAD_binding_2
Other DBs
NCBI-GeneID: 4339892
NCBI-ProteinID: XP_015642949
UniProt: Q9LI00
LinkDB
Position
6:643610..646721
AA seq 480 aa
MAVTRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVQRAKVEGNLPVYGFHDP
ASFVNSIQKPRVVIMLVKAGAPVDQTIATLAAHLEQGDCIIDGGNEWYENTERREKAMEE
RGLLYLGMGVSGGEEGARNGPSLMPGGSFEAYKYIEDILLKVAAQVPDSGPCVTYIGKGG
SGNFVKMVHNGIEYGDMQLISEAYDVLKSVGKLTNSELQQVFSEWNKGELLSFLIEITAD
IFSIKDDQGSGHLVDKVLDKTGMKGTGKWTVQQAAELSVAAPTIEASLDSRFLSGLKDER
VEAAKVFQGDFSSNLPVDKAQLIEDVRQALYASKICSYAQGMNIIKAKSMEKGWSLNLGE
LARIWKGGCIIRAIFLDRIKKAYDRNSDLANLLVDPEFAQEIMDRQAAWRRVVCLAINNG
VSTPGMSASLAYFDSYRRDRLPANLVQAQRDYFGAHTYERVDMPGSFHTEWFKIARAAKM
NT seq 1443 nt   +upstreamnt  +downstreamnt
atggctgtcactagaattggtcttgctggccttgcggtcatggggcagaaccttgccctc
aacattgcagagaaagggttccctatctctgtctacaacaggacgacttctaaggttgat
gagaccgttcagcgcgccaaggtagaaggaaaccttcctgtgtacgggttccatgaccct
gcatcctttgtgaactccattcagaagccacgtgttgtcatcatgcttgtcaaggctggt
gcaccagtggaccagaccattgcaactcttgcagcacacttggagcagggtgactgtatt
attgatggaggaaatgagtggtacgagaacactgagaggagggagaaggcaatggaggag
cgtggcctcctctatcttgggatgggtgtttccggaggagaggagggtgcccgcaatggc
ccgtccttgatgcctggtggctcattcgaggcgtacaagtacattgaagatattcttctc
aaggtggctgcccaggttcctgatagtggcccgtgcgtcacatacattggcaaaggtgga
tctggaaactttgtcaagatggttcacaacggaattgagtatggtgacatgcaactgatt
tctgaggcatatgatgttctcaagtcagttggtaagctcacaaacagtgagctgcagcag
gtgttttctgagtggaacaagggtgagctcctcagtttcctgattgagatcacagccgac
atatttagcatcaaggatgaccagggttcaggccacctggtcgacaaggtcctggacaag
actgggatgaagggaactgggaagtggactgtgcagcaggccgcagagctttctgtggct
gctcctacaattgaggcatccttggattccaggttcctcagtgggttgaaggatgagcgt
gttgaggctgccaaggtcttccaaggtgacttctccagcaacttgccagtggacaaggca
cagctgattgaagacgtgaggcaggctctttacgcctcgaagatctgcagctacgctcag
ggcatgaacatcatcaaggccaagagcatggagaaagggtggagcctcaacctcggtgag
ctagcgaggatctggaagggagggtgcatcatccgtgccatcttcctggaccgcatcaag
aaggcctacgacaggaactccgacctcgccaacctgctcgtggaccctgagttcgctcag
gagatcatggacaggcaagcggcatggcgcagggtggtctgccttgccatcaacaatggc
gtcagcaccccaggcatgtcggcgagtctcgcgtacttcgactcctaccggagggacagg
ctgcctgccaacctggtgcaggcacagagggactatttcggggctcacacctacgagagg
gtcgacatgcccggctccttccacaccgagtggttcaagatcgcgcgtgctgctaagatg
tga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4350528
Entry
4350528           CDS       T01015                                 
Name
(RefSeq) 6-phosphogluconate dehydrogenase, decarboxylating 2, chloroplastic
  KO
K00033  6-phosphogluconate dehydrogenase [EC:1.1.1.44 1.1.1.343]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00030  Pentose phosphate pathway
osa00480  Glutathione metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
Module
osa_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
osa_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    4350528
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    4350528
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.44  phosphogluconate dehydrogenase (NADP+-dependent, decarboxylating)
     4350528
    1.1.1.343  phosphogluconate dehydrogenase (NAD+-dependent, decarboxylating)
     4350528
SSDB
Motif
Pfam: 6PGD NAD_binding_2 RNR_Alpha
Other DBs
NCBI-GeneID: 4350528
NCBI-ProteinID: XP_015616899
UniProt: Q2R480
LinkDB
Position
11:17064401..17066285
AA seq 508 aa
MASPAPAPPAASSSAAGSAPPPRIGLAGLATMGQNLALNIAEKGFPISVYNRTAAKVDAT
VSRAEAEGALPVLGHRDPRGFVLSLSRPRTVVLLVQAGRAVDATIDALVPYLDAGDAIVD
GGNEWYQNTERRIEEAAARGILYLGMGVSGGEEGARNGPSLMPGGHIDAYNNIRDILEKA
AAQTEDGACVTFVGPGGAGNFVKMVHNGIEYGDMQLIAEAYDVLRRVGGLSNSEIADVFA
EWNRGELESFLVEITADIFTVADPLDGSGGGGLVDKILDKTGMKGTGKWTVQQAAELAIA
APTIAASLDGRYLSGLKDERVAAAGVLEAEGMPSGLLETINVDKKMLVDRVRQALYASKI
CSYAQGMNLLRAKSVEKGWNLNLAELARIWKGGCIIRAKFLDRIKKAYDRNPELANLIVD
REFAREMVQRQNAWRWVVARAVEAGISTPGMSASLSYFDTYRCSRLPANLIQAQRDLFGA
HTYERIDRPGSFHTEWTKLARKSNGAAI
NT seq 1527 nt   +upstreamnt  +downstreamnt
atggcctccccggcgccggcgccgcccgcggcctcctcctccgcggcggggtccgccccg
ccgccgcgcatcggcctcgcggggctcgccaccatgggccagaacctcgccctcaacatc
gccgagaagggcttcccgatctccgtctacaaccgcaccgccgccaaggtcgacgccacc
gtgtcccgcgccgaggccgagggcgcgctcccggtgctcggccaccgcgacccgcggggc
ttcgtcctctccctctccaggccccgcaccgtcgtgctgctcgtccaggccgggcgcgcc
gtcgacgccaccatcgacgcgctcgtcccctacctcgacgccggggacgccatcgtcgac
ggcgggaacgagtggtaccagaacacggagcggcggatcgaggaggccgccgcgaggggg
atactctacctcgggatgggggtctccggcggcgaggagggcgcgcggaacgggccctcg
ctgatgccggggggccacatcgacgcctacaacaacatcagggacatcctcgagaaggcc
gccgcgcagacggaggatggggcgtgcgtcaccttcgtcggccccggcggcgcgggcaac
ttcgttaagatggtgcacaacgggatcgagtacggcgacatgcagctcatcgccgaggcc
tacgacgtgctccgccgcgtcggcggcctgtccaactcggagatcgctgacgtcttcgcg
gagtggaaccggggggaattggagagtttcttggttgagattactgccgatatattcacg
gtggccgacccgcttgatggcagcggcggcggtgggctggtggacaagattcttgacaag
acggggatgaagggaaccgggaagtggacggtgcagcaggcagcagagcttgcgattgct
gcgcccacgattgcagcatcactggatgggaggtacttgtctgggttgaaggacgagcgt
gtggcggccgcaggggttctagaggcggaggggatgccatcagggctactcgagacgatt
aatgttgataagaagatgctagttgacagggtgaggcaagctctgtatgcgtcaaagatt
tgcagctacgcgcaggggatgaaccttctgcgagcaaagagtgtggagaaggggtggaat
cttaacctcgcagagcttgcaaggatttggaagggcgggtgcattatccgggcgaagttt
cttgataggatcaagaaggcgtatgacaggaaccctgagctggccaatctgatcgtggac
agggagtttgcaagggagatggttcagcggcagaatgcatggcggtgggttgtggctcgt
gctgtggaggctgggattagcactccagggatgtctgctagcctttcatactttgacacc
tacaggtgtagtcggctgcctgcaaatctgatccaagcacagagagacttgtttggggca
cacacctatgagcgcattgaccgtccaggttcgttccacacagagtggactaagctggcg
agaaagagtaatggtgcggccatttga

DBGET integrated database retrieval system