KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4340018
Entry
4340018           CDS       T01015                                 
Name
(RefSeq) granule-bound starch synthase 1, chloroplastic/amyloplastic isoform X2
  KO
K13679  granule-bound starch synthase [EC:2.4.1.242]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00500  Starch and sucrose metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00854  Glycogen biosynthesis, glucose-1P => glycogen/starch
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    4340018
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:osa01003]
    4340018
Enzymes [BR:osa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.242  NDP-glucose---starch glucosyltransferase
     4340018
Glycosyltransferases [BR:osa01003]
 Polysaccharide
  Storage polysaccharide
   4340018
SSDB
Motif
Pfam: Glyco_transf_5 Glycos_transf_1 Glyco_trans_1_4 Glyco_transf_4 Glyco_tran_WecG
Other DBs
NCBI-GeneID: 4340018
NCBI-ProteinID: XP_015644490
UniProt: Q0DEV5 B7EHV0 A0A8J8YHT8
Structure
LinkDB
Position
6:1765524..1770644
AA seq 609 aa
MSALTTSQLATSATGFGIADRSAPSSLLRHGFQGLKPRSPAGGDATSLSVTTSARATPKQ
QRSVQRGSRRFPSVVVYATGAGMNVVFVGAEMAPWSKTGGLGDVLGGLPPAMAANGHRVM
VISPRYDQYKDAWDTSVVAEIKVADRYERVRFFHCYKRGVDRVFIDHPSFLEKVWGKTGE
KIYGPDTGVDYKDNQMRFSLLCQAALEAPRILNLNNNPYFKGTYGEDVVFVCNDWHTGPL
ASYLKNNYQPNGIYRNAKVAFCIHNISYQGRFAFEDYPELNLSERFRSSFDFIDGYDTPV
EGRKINWMKAGILEADRVLTVSPYYAEELISGIARGCELDNIMRLTGITGIVNGMDVSEW
DPSKDKYITAKYDATTAIEAKALNKEALQAEAGLPVDRKIPLIAFIGRLEEQKGPDVMAA
AIPELMQEDVQIVLLGTGKKKFEKLLKSMEEKYPGKVRAVVKFNAPLAHLIMAGADVLAV
PSRFEPCGLIQLQGMRYGTPCACASTGGLVDTVIEGKTGFHMGRLSVDCKVVEPSDVKKV
AATLKRAIKVVGTPAYEEMVRNCMNQDLSWKGPAKNWENVLLGLGVAGSAPGIEGDEIAP
LAKENVAAP
NT seq 1830 nt   +upstreamnt  +downstreamnt
atgtcggctctcaccacgtcccagctcgccacctcggccaccggcttcggcatcgccgac
aggtcggcgccgtcgtcgctgctccgccacgggttccagggcctcaagccccgcagcccc
gccggcggcgacgcgacgtcgctcagcgtgacgaccagcgcgcgcgcgacgcccaagcag
cagcggtcggtgcagcgtggcagccggaggttcccctccgtcgtcgtgtacgccaccggc
gccggcatgaacgtcgtgttcgtcggcgccgagatggccccctggagcaagaccggcggc
ctcggtgacgtcctcggtggcctcccccctgccatggctgcgaatggccacagggtcatg
gtgatctctcctcggtacgaccagtacaaggacgcttgggataccagcgttgtggctgag
atcaaggttgcagacaggtacgagagggtgaggtttttccattgctacaagcgtggagtc
gaccgtgtgttcatcgaccatccgtcattcctggagaaggtttggggaaagaccggtgag
aagatctacggacctgacactggagttgattacaaagacaaccagatgcgtttcagcctt
ctttgccaggcagcactcgaggctcctaggatcctaaacctcaacaacaacccatacttc
aaaggaacttatggtgaggatgttgtgttcgtctgcaacgactggcacactggcccactg
gcgagctacctgaagaacaactaccagcccaatggcatctacaggaatgcaaaggttgct
ttctgcatccacaacatctcctaccagggccgtttcgctttcgaggattaccctgagctg
aacctctccgagaggttcaggtcatccttcgatttcatcgacgggtatgacacgccggtg
gagggcaggaagatcaactggatgaaggccggaatcctggaagccgacagggtgctcacc
gtgagcccgtactacgccgaggagctcatctccggcatcgccaggggatgcgagctcgac
aacatcatgcggctcaccggcatcaccggcatcgtcaacggcatggacgtcagcgagtgg
gatcctagcaaggacaagtacatcaccgccaagtacgacgcaaccacggcaatcgaggcg
aaggcgctgaacaaggaggcgttgcaggcggaggcgggtcttccggtcgacaggaaaatc
ccactgatcgcgttcatcggcaggctggaggaacagaagggccctgacgtcatggccgcc
gccatcccggagctcatgcaggaggacgtccagatcgttcttctgggtactggaaagaag
aagttcgagaagctgctcaagagcatggaggagaagtatccgggcaaggtgagggccgtg
gtgaagttcaacgcgccgcttgctcatctcatcatggccggagccgacgtgctcgccgtc
cccagccgcttcgagccctgtggactcatccagctgcaggggatgagatacggaacgccc
tgtgcttgcgcgtccaccggtgggctcgtggacacggtcatcgaaggcaagactggtttc
cacatgggccgtctcagcgtcgactgcaaggtggtggagccaagcgacgtgaagaaggtg
gcggccaccctgaagcgcgccatcaaggtcgtcggcacgccggcgtacgaggagatggtc
aggaactgcatgaaccaggacctctcctggaaggggcctgcgaagaactgggagaatgtg
ctcctgggcctgggcgtcgccggcagcgcgccggggatcgaaggcgacgagatcgcgccg
ctcgccaaggagaacgtggctgctccttga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4343010
Entry
4343010           CDS       T01015                                 
Name
(RefSeq) granule-bound starch synthase 1b, chloroplastic/amyloplastic
  KO
K13679  granule-bound starch synthase [EC:2.4.1.242]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00500  Starch and sucrose metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00854  Glycogen biosynthesis, glucose-1P => glycogen/starch
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    4343010
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:osa01003]
    4343010
Enzymes [BR:osa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.242  NDP-glucose---starch glucosyltransferase
     4343010
Glycosyltransferases [BR:osa01003]
 Polysaccharide
  Storage polysaccharide
   4343010
SSDB
Motif
Pfam: Glyco_transf_5 Glycos_transf_1 Glyco_trans_1_4
Other DBs
NCBI-GeneID: 4343010
NCBI-ProteinID: XP_015647210
UniProt: A0A0N7KNB2 Q8GTK0
LinkDB
Position
7:complement(12916432..12924320)
AA seq 608 aa
MARTMGSTPTYCSYQTNGVGALKQSPHMQFQQSYNYGVRFLKRDTLSVRINKHMAKRIAT
STGICTKPRRSHMPIVCSAGMTIIFIATECHPWCKTGGLGDVLGGLPPALAAMGHRVMTI
VPRYDQYKDAWDTNVLVEVNIGDRTETVRFFHCYKRGVDRVFVDHPMFLEKVWGKTGPKL
YGPTTGDDYRDNQLRFCLLCLAALEAPRVLNLNNSEYFSGPYGENVVFVANDWHTGVLPC
YLKSIYQAKGMYVNAKVAFCIHNIAYQGRFAREDFELLNLPDSFLPSFDFIDGHFKPVVG
RKINWMKAGITECDLVMTVSPHYVKELASGPDKGVELDGILRTKPLETGIVNGMDVYEWN
PATDQYISVKYDATTVTEARALNKEMLQAEVGLPVDSSIPLIVFVGRLEEQKGSDILIAA
IPEFVEGNVQIIVLGTGKKKMEEELILLEVKYPNNARGIAKFNVPLAHMMFAGADFIIVP
SRFEPCGLIQLQGMRYGVVPICSSTGGLVDTVKEGVTGFHMGLFNVECETVDPVDVTAVA
STVKRALKQYNTPAFQEMVQNCMAQDLSWKGPAKKWEEVLLGLGVEGSQPGIEGEELAPL
AKENVATP
NT seq 1827 nt   +upstreamnt  +downstreamnt
atggctagaacaatgggttcaacacctacctactgctcttaccaaacaaatggtgttggc
gctttaaagcaatcacctcatatgcaattccaacaatcgtacaactatggagttaggttc
ctaaagagggataccctttctgtgcggattaacaaacatatggccaaaagaatagcaaca
agcactggaatttgcactaagcctaggaggtctcacatgcctatagtatgctctgctgga
atgacaataatttttattgcaactgaatgtcacccatggtgcaaaactggaggcctcggt
gatgttctagggggactgccccctgctcttgctgcaatgggacatcgtgtcatgacaata
gttcctcgttatgatcaatacaaagatgcatgggatacaaatgtccttgtcgaggtcaat
attggtgacaggacagaaacagtgcgcttcttccactgctataaaaggggagttgaccgt
gtttttgttgatcatcctatgtttcttgagaaggtatggggcaagactggaccaaaatta
tacggtcctaccactggagatgactaccgggacaaccagttgcggttctgccttttatgc
ctcgctgctttggaggctccaagggttctcaatctcaacaattctgaatatttctcggga
ccatatggtgaaaatgttgtcttcgttgcaaatgactggcacactggagtcctgccatgc
tatctcaagagcatctatcaggcaaaaggaatgtatgtgaatgctaaggttgctttctgc
attcacaatattgcctaccagggtagatttgccagagaagactttgaacttcttaatcta
ccggacagtttcctgccttcatttgattttattgatgggcattttaaacctgtagtaggt
agaaagattaactggatgaaggcagggatcactgaatgtgatctggttatgacggttagt
ccacattatgtcaaagaactcgcttctggcccagataaaggtgttgaattggatggcatc
cttcgcacaaagccccttgaaactggaattgtcaatggcatggatgtttatgaatggaat
ccagcaacagatcagtacatcagcgtgaaatacgatgcaacaacggtaactgaagcaagg
gcactcaataaggaaatgctacaagctgaagttgggttgcctgtggactcgagcattcct
ttaatagtttttgttggtcgtcttgaagagcagaaagggtcagacatactaattgcagcc
attccagagttcgtggaggggaatgtccagataattgttcttggtacagggaagaagaaa
atggaggaggaactgatactgctcgaagttaaatatccaaacaacgctagagggatagca
aaatttaatgttcctttagcgcatatgatgtttgctggggctgattttataattgttcct
agtaggtttgagccatgtggtctcatccaattgcaagggatgagatatggagtggttccc
atctgctcatctactggaggacttgtcgacacggttaaggagggcgtgaccggattccac
atgggtttgttcaatgtcgagtgcgaaactgttgatccagtggacgtcacagcggttgct
tcaactgtcaaacgggctctgaagcagtacaacacaccggcattccaagaaatggttcag
aactgcatggctcaagacctatcttggaagggacctgcaaagaagtgggaggaggttctt
cttgggttgggcgttgaggggagccagccaggcatcgagggtgaggagctggcgccactt
gccaaggaaaacgtggccactccctga

DBGET integrated database retrieval system