KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4340093
Entry
4340093           CDS       T01015                                 
Name
(RefSeq) palmitoyl-acyl carrier protein thioesterase, chloroplastic
  KO
K10781  fatty acyl-ACP thioesterase B [EC:3.1.2.14 3.1.2.21]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00061  Fatty acid biosynthesis
osa01100  Metabolic pathways
osa01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    4340093
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:osa01004]
    4340093
Enzymes [BR:osa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.14  oleoyl-[acyl-carrier-protein] hydrolase
     4340093
    3.1.2.21  dodecanoyl-[acyl-carrier-protein] hydrolase
     4340093
Lipid biosynthesis proteins [BR:osa01004]
 Fatty acid synthase
  Component type
   4340093
SSDB
Motif
Pfam: Acyl-ACP_TE Acyl-thio_N 4HBT_2
Other DBs
NCBI-GeneID: 4340093
NCBI-ProteinID: XP_015644420
UniProt: A3B8B2 Q9SNP5
LinkDB
Position
6:2274694..2279492
AA seq 427 aa
MAGSLAASAFFPVPGSSPAASARSSKNTTGELPENLSVRGIVAKPNPSPGAMQVKAQAQA
LPKVNGTKVNLKTTSPDKEDIIPYTAPKTFYNQLPDWSMLLAAVTTIFLAAEKQWTLLDW
KPKKPDMLADTFGFGRIIQDGLVFRQNFLIRSYEIGADRTASIETLMNHLQETALNHVKT
AGLLGDGFGATPEMSKRNLIWVVSKIQLLVERYPSWGDMVQVDTWVAAAGKNGMRRDWHV
RDYNSGQTILRATSVWVMMNKNTRRLSKMPDEVRAEIGPYFNGRSAISEEQGEKLPKPGT
TFDGAATKQFTRKGLTPKWSDLDVNQHVNNVKYIGWILESAPISILEKHELASMTLDYRK
ECGRDSVLQSLTAVSGECDDGNTESSIQCDHLLQLESGADIVKAHTEWRPKRAQGEGNMG
FFPAESA
NT seq 1284 nt   +upstreamnt  +downstreamnt
atggctggttctcttgcggcgtctgcattcttccctgtcccagggtcttcccctgcagct
tcggctagaagctctaagaacacaaccggtgaattgccagagaatttgagtgtccgcgga
atcgtcgcgaagcctaatccgtctccaggggccatgcaagtcaaggcgcaggcgcaagcc
cttcctaaggttaatggaaccaaggttaacctgaagactacaagcccagacaaggaggat
ataataccgtacactgctccgaagacattctataaccaattgccagactggagcatgctt
cttgcagctgtcacgaccattttcctggcagctgagaagcagtggactctgcttgactgg
aagccgaagaagcctgacatgctggctgacacattcggctttggtaggatcatccaagac
gggctggtgtttaggcaaaacttcttgattcggtcctacgagattggtgctgatcgtaca
gcttctattgagacattaatgaatcatttacaggaaacagctctgaaccatgtgaaaact
gctggtctcttaggtgatggttttggtgctacgccggagatgagcaaacggaacttaata
tgggttgtcagcaaaattcagcttcttgttgagcgatacccatcatggggagatatggtc
caagttgacacatgggtagctgctgctggcaaaaatggcatgcgtcgagattggcatgtt
cgggactacaactctggtcaaacaatcttgagggctacaagtgtttgggtgatgatgaat
aagaacactagaagactttcaaaaatgccagatgaagttagagctgaaataggcccgtat
ttcaatggccgttctgctatatcagaggagcagggtgaaaagttgcctaagccagggacc
acatttgatggcgctgctaccaaacaattcacaagaaaagggcttactccgaagtggagt
gaccttgatgtcaaccagcatgtgaacaatgtgaagtatattggttggatacttgagagt
gctccaatttcgatactggagaagcacgagcttgcaagcatgaccttggattacaggaag
gagtgtggccgtgacagtgtgcttcagtcgcttaccgctgtttcaggtgaatgcgatgat
ggcaacacagaatcctccatccagtgtgaccatctgcttcagctggagtccggagcagac
attgtgaaggctcacacagagtggcgaccgaagcgagctcagggcgaggggaacatgggc
tttttcccagctgagagtgcatga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4341431
Entry
4341431           CDS       T01015                                 
Name
(RefSeq) palmitoyl-acyl carrier protein thioesterase, chloroplastic
  KO
K10781  fatty acyl-ACP thioesterase B [EC:3.1.2.14 3.1.2.21]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00061  Fatty acid biosynthesis
osa01100  Metabolic pathways
osa01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    4341431
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:osa01004]
    4341431
Enzymes [BR:osa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.14  oleoyl-[acyl-carrier-protein] hydrolase
     4341431
    3.1.2.21  dodecanoyl-[acyl-carrier-protein] hydrolase
     4341431
Lipid biosynthesis proteins [BR:osa01004]
 Fatty acid synthase
  Component type
   4341431
SSDB
Motif
Pfam: Acyl-ACP_TE Acyl-thio_N 4HBT_2
Other DBs
NCBI-GeneID: 4341431
NCBI-ProteinID: XP_015644302
UniProt: A3BD96
LinkDB
Position
6:23467206..23471722
AA seq 423 aa
MAGSIAASAFLPGSPAAAPPKSVLGERPDSLDVRGIAAKPGSSSSAAALRAGKTRTHAAI
PKVNGGSSALADPEHDTMSSSSSSAAPRTFYNQLPDWSMLLAAITTIFLAAEKQWTLLDW
KPKRPDMLTDTFGFGRMIHEGLMFRQNFSIRSYEIGADRTASIETLMNHLQETALNHVKS
AGLLGDGFGSTPEMSKRDLFWVVSQMQAIVERYPCWGDTVEVDTWVGAHGKNGMRRDWHI
RDSVTGHTILKATSKWVMMHKLTRRLARIPDEVRTEIEPYFFEHASIVDEDNQKLPKLPD
IEGANVAKYVRTGLTPRWADLDINQHVNNVKYIGWILESAPISILEKHELASIVLDYKRE
CGRDSVLQSHTTVYTDCNKHSGQTTLHCEHLLSLESGPTIVKARTMWRPKGTRPQESIIP
SSS
NT seq 1272 nt   +upstreamnt  +downstreamnt
atggccggctcaatcgccgcctcggcgttcttgccggggtcgccggcggccgcgccgccc
aagagcgtcctgggcgagcgcccggacagcctggacgtccgcggcatcgccgcgaagccg
ggctcctcgtcgtcggccgccgccctgagggccggcaagacgcgcacccacgccgccatc
cccaaggtgaacggcggcagttcggcgctggcggatccggagcacgacacgatgtcctcc
tcctcctcctccgcggcgccgaggacgttctacaaccagctccccgactggagcatgctc
ctcgcagccatcacgaccatcttcttggccgcggagaagcagtggacgctgctggactgg
aagccgaagcggcccgacatgctcaccgacacgttcggtttcggcaggatgatacatgag
gggctcatgttcaggcagaacttctcgattaggtcctatgagatcggggccgataggacg
gcgtctatagaaacgctgatgaaccatttgcaggaaaccgcactgaatcatgtgaagagc
gctgggctgctaggagatggttttggctcaacgccagagatgagtaaacgagacttgttc
tgggttgtcagccaaatgcaggcaatcgttgagcgttatccgtgctggggtgatactgtc
gaagtagatacatgggttggtgctcatggtaaaaatggaatgcgcagagactggcatata
cgtgattctgtaacaggccatacaatattgaaggctacaagtaaatgggttatgatgcac
aagcttacaaggaggctagcaagaattcctgatgaagtacgtactgaaatagagccatac
ttttttgagcatgcttctattgtagatgaagacaaccagaaacttccaaaactgccagat
attgaaggtgctaatgtagccaaatatgtccggacaggcctgactccacgatgggccgac
cttgatatcaatcagcatgttaataacgttaaatacatagggtggatcctagagagcgca
ccaatctccattctggagaaacatgagctggcaagtattgtcctggattacaagagggag
tgtggccgagacagcgtgctgcaatcacacactaccgtgtacactgactgcaacaagcac
tctggacaaaccactttgcactgtgagcatttgctgagcctggaatcaggacctaccatc
gtcaaggccaggaccatgtggaggccaaaaggaaccaggccccaagagagtatcattccg
tcttcgtcgtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4351056
Entry
4351056           CDS       T01015                                 
Name
(RefSeq) palmitoyl-acyl carrier protein thioesterase, chloroplastic
  KO
K10781  fatty acyl-ACP thioesterase B [EC:3.1.2.14 3.1.2.21]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00061  Fatty acid biosynthesis
osa01100  Metabolic pathways
osa01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    4351056
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:osa01004]
    4351056
Enzymes [BR:osa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.14  oleoyl-[acyl-carrier-protein] hydrolase
     4351056
    3.1.2.21  dodecanoyl-[acyl-carrier-protein] hydrolase
     4351056
Lipid biosynthesis proteins [BR:osa01004]
 Fatty acid synthase
  Component type
   4351056
SSDB
Motif
Pfam: Acyl-ACP_TE Acyl-thio_N 4HBT_2
Other DBs
NCBI-GeneID: 4351056
NCBI-ProteinID: XP_015617879
UniProt: A3CDM0 Q2R045
LinkDB
Position
11:complement(26468416..26473266)
AA seq 425 aa
MAGSLAASAFFPGPGSSPAASARSSKNAAVTGELPENLSVRGIVAKPNPPPAAMQVKAQA
QTLPKVNGTKVNLKTVKPDMEETVPYSAPKTFYNQLPDWSMLLAAITTIFLAAEKQWTLL
DWKPKKPDMLVDTFGFGRIIQDGMVFRQNFMIRSYEIGADRTASIETLMNHLQETALNHV
RTAGLLGDGFGATPEMSKRNLIWVVSKIQLLVEQYPAWGDTVQVDTWVAAAGKNGMRRDW
HVRDYNSGRTILRATSVWVMMHKKTRRLSKMPDEVRAEIGPYFNDRSAITEEQSEKLAKT
GNKVGDDATEQFIRKGLTPRWGDLDVNQHVNNVKYIGWILESAPISVLEKHELASMTLDY
RKECGRDSVLQSLTTVSGECTSIGADKQASAIQCDHLLQLESGADIVKAHTEWRPKRSHA
AAENA
NT seq 1278 nt   +upstreamnt  +downstreamnt
atggcagggtctcttgccgcctcagcattcttcccaggtccaggctcatctcctgcagca
tcagctagaagctccaagaatgctgctgttaccggcgaattgccggagaatttgagtgtc
cgtggcattgtcgcaaagcctaacccacctcctgcagccatgcaagtaaaggcacaggct
caaacccttcccaaggttaatggtacgaaggttaacctcaagacggtgaagcctgacatg
gaggaaacggtgccttacagtgctccaaagacgttctataaccaactgccggattggagc
atgcttcttgcggctattacaaccatcttccttgccgcagagaagcagtggacactgctt
gattggaagccaaagaaacctgacatgcttgttgacacatttggctttggtaggattatc
caggacggtatggtgtttaggcagaacttcatgattcggtcctacgagattggtgctgat
cgtacagcttctatagagacattgatgaatcatttacaggaaacagctcttaaccatgtg
aggactgctggtcttcttggagatggttttggggctacaccggagatgagcaaacggaac
ttgatatgggttgtcagcaaaatccagcttcttgttgagcaataccccgcatggggagat
acggttcaagttgacacatgggttgctgctgctggcaaaaatggcatgcgtcgagactgg
catgttcgtgactacaactctggccgaacaatcttgagagctacaagtgtttgggtgatg
atgcacaagaaaactagaagactttcaaaaatgccagatgaagttagagctgaaataggc
ccatatttcaatgaccgttcagctataacagaggagcagagtgaaaagttagccaagaca
ggaaataaagttggtgatgatgctacagagcaattcataagaaaggggctcactcctaga
tggggtgacctcgatgtcaatcagcatgtgaacaatgttaaatatattgggtggatcctt
gagagtgctccaatttcagtactggagaagcatgagcttgcaagcatgaccctggattac
aggaaggagtgtggtcgagacagcgtgctgcaatcacttaccaccgtgtcaggggaatgc
accagcattggcgccgacaagcaggcttctgccatccagtgcgaccatcttcttcagctt
gagtcaggagctgatattgtgaaggcacacacagagtggcgaccaaagcgatcgcacgca
gcagctgagaacgcgtaa

DBGET integrated database retrieval system