KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4340143
Entry
4340143           CDS       T01015                                 
Name
(RefSeq) uncharacterized protein LOC4340143
  KO
K20776  BRISC and BRCA1-A complex member 1
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    4340143
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:osa04121]
    4340143
   03036 Chromosome and associated proteins [BR:osa03036]
    4340143
   03400 DNA repair and recombination proteins [BR:osa03400]
    4340143
Ubiquitin system [BR:osa04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   BRISC complex
    4340143
Chromosome and associated proteins [BR:osa03036]
 Eukaryotic type
  Centrosome formation proteins
   Microtubules and associated factors
    BRISC complex
     4340143
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    BRCA1-A complex
     4340143
SSDB
Motif
Pfam: VWA_2
Other DBs
NCBI-GeneID: 4340143
NCBI-ProteinID: XP_015642976
UniProt: Q5VND0 A0A0P0WT35
LinkDB
Position
6:complement(2584083..2586240)
AA seq 285 aa
MDPTPHRGGSPSPRFTLQPSRLPPEDMLFCVDVDLETRSEMRIAPGPAAAAAASPGAAGA
SSGAAAASRQAARPPVKRMDAVKQALLLFVHSKLTMCPDHRFAFASLGDTVSLVKKDFSS
DAGSAVEAIQSLDASETRYAMADLTQLFKIAYQEGKRAELQGRLLRVVLIYCRSSTKPQH
QWPIKQKNFTLDIIYLHDKPTADNCPQKVYDALVDALEHVSQYEGYILETGQGLARILFR
QTCILLSHPLQRCIQDDLDIPKPLAKKNMVTEAAQNEDGMPVSTQ
NT seq 858 nt   +upstreamnt  +downstreamnt
atggaccccacgcctcaccgcggcggctcgccgtcgccgaggttcacgctgcagccgagc
cgcctcccgccggaggacatgctcttctgcgtcgacgtcgacctggagacgcgctccgag
atgaggatcgccccgggccccgccgccgccgccgccgcgtcgccgggcgccgcgggggct
tcctcgggggccgcggctgcttccaggcaggccgctcggccgccggtgaagaggatggac
gccgtcaagcaggcgctcctgctcttcgtccacagcaagctcaccatgtgccccgatcac
cgcttcgccttcgcctccctcggcgacaccgtctccttggtaaagaaggatttcagcagt
gatgctggttctgcagtggaggcaatccaatccctggatgcgtcggaaacgagatatgcg
atggctgatctcactcagctcttcaagatagcttaccaggaagggaaaagagcagaattg
caaggccgcctactcagagtggtactcatctactgccgttcctcaactaagcctcaacat
cagtggcccatcaagcaaaagaatttcaccttggacataatctatcttcatgacaagcct
actgctgataactgtccacagaaggtatatgatgctttggttgatgcacttgagcatgtc
agccagtatgagggatacattctagagactggtcaggggcttgctcgaatcctgttccgt
cagacttgcattcttctgtcgcatcccttacagcgttgcatccaagatgaccttgatatt
cccaagccacttgctaagaaaaatatggttactgaagctgcgcagaacgaagatggcatg
ccagtctccacccagtag

DBGET integrated database retrieval system