KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4340171
Entry
4340171           CDS       T01015                                 
Name
(RefSeq) uncharacterized protein LOC4340171
  KO
K01633  7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00790  Folate biosynthesis
osa01100  Metabolic pathways
osa01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    4340171
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.81  7,8-dihydroneopterin oxygenase
     4340171
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.25  dihydroneopterin aldolase
     4340171
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.99  Acting on other compounds
    5.1.99.8  7,8-dihydroneopterin epimerase
     4340171
SSDB
Motif
Pfam: FolB RexA
Other DBs
NCBI-GeneID: 4340171
NCBI-ProteinID: XP_015642205
LinkDB
Position
6:complement(2816174..2817299)
AA seq 245 aa
MENPQNDGTRAYPRSETRSDYLRRKDKHELDAHPSPRHAAGERRRCLPWRPAAPVSSLVL
PPHRAAPSSCCCFPSLPPPVSTTTTDESIQIPVCCRTKDSFRALRTIMAERELIDRDKLV
LIDLQFHGFHGVKSEEKTLGQKFVVDVDAWMDLSVAGETDSISDTVSYTDIYGIAKDVVE
GPSRNLLEAVAHRIASNALLKFPQISTIRVKVGKPHVAVRGIVDYLGVEILRHRKDVGGD
RQELH
NT seq 738 nt   +upstreamnt  +downstreamnt
atggagaacccacaaaacgacggaacacgtgcttacccacgtagtgaaacaagatcggac
tacctaaggcggaaggataagcatgaactcgacgcccatccttctcctcgccacgccgcc
ggcgagcggcggcgctgcctgccgtggcgtcctgctgctcccgtctcctcgctggttctc
ccaccgcaccgcgccgcgccgtcgtcctgctgctgcttcccttcccttccgcctccggtg
agcaccaccaccaccgatgaatcgatccaaatacccgtgtgctgccggactaaggattcg
ttccgtgctttaaggaccattatggcggagagggagttaatcgacagggataaactcgtg
cttatagatttgcagttccacggtttccatggagtgaaatcagaagagaaaactctaggt
caaaagttcgttgtggatgttgatgcgtggatggatttgagtgttgctggggagactgac
agcatatctgatacggttagctacacagatatctacgggattgccaaggatgttgttgaa
ggcccatcgcggaaccttttggaagcagtagctcatcgaatcgcaagtaacgcattgctt
aagttccctcaaatctcaaccatcagagtgaaagttgggaaacctcatgttgctgtacgt
ggaatcgtcgattatttgggtgttgagatattgaggcatagaaaagatgtgggaggcgat
cgtcaggagcttcattga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4346285
Entry
4346285           CDS       T01015                                 
Name
(RefSeq) dihydroneopterin aldolase 2
  KO
K01633  7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00790  Folate biosynthesis
osa01100  Metabolic pathways
osa01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    4346285
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.81  7,8-dihydroneopterin oxygenase
     4346285
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.25  dihydroneopterin aldolase
     4346285
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.99  Acting on other compounds
    5.1.99.8  7,8-dihydroneopterin epimerase
     4346285
SSDB
Motif
Pfam: FolB Uricase Ribosomal_L11
Other DBs
NCBI-GeneID: 4346285
NCBI-ProteinID: XP_015648276
UniProt: A3BVN5 Q6Z0T7
LinkDB
Position
8:27832983..27834136
AA seq 135 aa
MAGKKEEEEAVVYRGDKLILRGLRFHGTHGVKPEEKKLGQKFVIDVDAWMDLAAAGDSDD
ISDTVSYTEIYRIAKNVVEGPSHNLLESVAQSIANSTLLKFPQISAVRVKVEKPHVAVQG
VLDYLGVEIFRQRKA
NT seq 408 nt   +upstreamnt  +downstreamnt
atggcggggaagaaggaggaggaggaggctgttgtgtacaggggcgacaagctgatcctg
cgggggctgcggttccatggcacccacggggtgaagccagaggagaagaagctgggccag
aagttcgtcatcgacgtcgacgcctggatggatctcgccgccgccggggactccgacgac
atctccgacaccgtcagctacaccgaaatctacaggatagccaagaatgtagtcgaaggc
ccgtcgcacaatctgttggaatcggtggctcagtcgattgcaaactcaaccctgctcaag
ttccctcagatttctgcagttcgagtgaaggttgagaaacctcatgttgctgttcaggga
gtcctcgactatttgggcgtggagatattcaggcagagaaaagcatga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4347851
Entry
4347851           CDS       T01015                                 
Name
(RefSeq) dihydroneopterin aldolase 2 isoform X1
  KO
K01633  7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00790  Folate biosynthesis
osa01100  Metabolic pathways
osa01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    4347851
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.81  7,8-dihydroneopterin oxygenase
     4347851
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.25  dihydroneopterin aldolase
     4347851
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.99  Acting on other compounds
    5.1.99.8  7,8-dihydroneopterin epimerase
     4347851
SSDB
Motif
Pfam: FolB RexA
Other DBs
NCBI-GeneID: 4347851
NCBI-ProteinID: XP_015611962
UniProt: Q653Q4 Q653D9
LinkDB
Position
9:22272947..22274952
AA seq 208 aa
MLSFARTSFGGQTAHLPKSKSSGYKHFVSISSGLPCFLAIRRQSPGYSSVHTASFSSQHN
QLSTDRSGTVMAERELIDKDKLILRGLQFHGFHGVKQEEKTLGQKFVVDVDAWMDLSAAG
ETDSISDTVSYTDIYRIAKDVVEGPSRNLLEAVAHRIASATLLKFPQISAVRVKVGKPHV
AVQGIVDYLGVEILRYRKDVGGDRQELH
NT seq 627 nt   +upstreamnt  +downstreamnt
atgctctcatttgcacgcactagctttgggggtcagactgcacatctgcctaagtctaaa
agttcaggatataaacattttgtgtccatctccagtggtctcccatgcttcctcgccatc
aggcggcaatctcctggctatagttcagttcacacagcttccttcagttcacaacacaat
caattgagcacggataggtcaggtactgttatggcagaaagggagctaatcgacaaggat
aaacttatacttagaggtttgcagttccatggtttccatggagtgaaacaagaagagaag
actctgggccaaaagtttgttgtggatgttgatgcgtggatggatttgagtgctgctggg
gaaactgacagcatatctgatacagttagctacacagatatttacaggattgccaaggat
gttgttgaaggcccatcgcggaaccttttggaggcagtagctcatcgcatcgcgagtgcc
acattgctgaaattccctcaaatctcagccgtcagagtgaaagttgggaaacctcatgtt
gcggtacaaggaatcgtcgattatttaggcgttgagatattgaggtacagaaaagacgta
ggaggcgatcgtcaggagcttcattga

DBGET integrated database retrieval system