KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4340240
Entry
4340240           CDS       T01015                                 
Name
(RefSeq) caffeoyl-CoA O-methyltransferase 1
  KO
K00588  caffeoyl-CoA O-methyltransferase [EC:2.1.1.104]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00940  Phenylpropanoid biosynthesis
osa00941  Flavonoid biosynthesis
osa00945  Stilbenoid, diarylheptanoid and gingerol biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00039  Monolignol biosynthesis, phenylalanine/tyrosine => monolignol
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00940 Phenylpropanoid biosynthesis
    4340240
   00945 Stilbenoid, diarylheptanoid and gingerol biosynthesis
    4340240
   00941 Flavonoid biosynthesis
    4340240
Enzymes [BR:osa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.104  caffeoyl-CoA O-methyltransferase
     4340240
SSDB
Motif
Pfam: Methyltransf_3 Methyltransf_24
Other DBs
NCBI-GeneID: 4340240
NCBI-ProteinID: XP_015643224
UniProt: A0A0P0WTG9 Q9XJ19
LinkDB
Position
6:3314079..3315447
AA seq 260 aa
MAEAASAAAAATTEQANGSSGGEQKTRHSEVGHKSLLKSDDLYQYILETSVYPREHECMK
ELREVTANHPWNLMTTSADEGQFLNLLLKLIGAKKTMEIGVYTGYSLLATALAIPDDGTI
LAMDINRENYELGLPSIEKAGVAHKIDFREGPALPVLDQLVEEEGNHGSFDFVFVDADKD
NYLNYHERLMKLVKVGGLVGYDNTLWNGSVVLPADAPMRKYIRYYRDFVLELNKALAADH
RVEICQLPVGDGITLCRRVK
NT seq 783 nt   +upstreamnt  +downstreamnt
atggccgaggcggcgtcggcggcggcggcggcgacgacggagcaggcgaatgggagcagc
ggcggcgagcagaagacgcggcactcggaggtcggccacaagagcctcctcaagagcgac
gatctctaccagtacatcctggagacgagcgtgtacccgcgcgagcacgagtgcatgaag
gagctccgcgaggtcaccgccaaccacccatggaacctgatgacgacgtcggcggacgag
gggcaattcctgaacctgctgctgaagctcatcggcgccaagaagaccatggagatcggc
gtctacaccggctactccctcctcgccaccgccctcgccatccccgacgacggcacgatc
ttggcgatggacatcaaccgggagaactacgagctggggctcccgtcgatcgagaaggcg
ggagtggcgcacaagatcgacttccgggagggacccgcgctgccggtgctggaccagctg
gtggaggaggagggcaaccatgggtcgttcgacttcgtgttcgtcgacgccgacaaggac
aactacctcaactaccacgagcggctgatgaagctggtcaaggtcggcggcctcgtcggc
tacgacaacacgctctggaacggctccgtcgtgctccccgccgacgcccccatgcgcaag
tacatccgctactaccgcgacttcgtgctcgagctcaacaaggccctcgccgccgaccac
cgcgtcgagatctgccagctccccgtcggcgacggcatcaccctctgccgccgcgtcaag
tga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4347397
Entry
4347397           CDS       T01015                                 
Name
(RefSeq) probable caffeoyl-CoA O-methyltransferase At4g26220
  KO
K00588  caffeoyl-CoA O-methyltransferase [EC:2.1.1.104]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00940  Phenylpropanoid biosynthesis
osa00941  Flavonoid biosynthesis
osa00945  Stilbenoid, diarylheptanoid and gingerol biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00039  Monolignol biosynthesis, phenylalanine/tyrosine => monolignol
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00940 Phenylpropanoid biosynthesis
    4347397
   00945 Stilbenoid, diarylheptanoid and gingerol biosynthesis
    4347397
   00941 Flavonoid biosynthesis
    4347397
Enzymes [BR:osa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.104  caffeoyl-CoA O-methyltransferase
     4347397
SSDB
Motif
Pfam: Methyltransf_3 Methyltransf_24
Other DBs
NCBI-GeneID: 4347397
NCBI-ProteinID: XP_015610959
UniProt: Q652C2 Q69QR4
LinkDB
Position
9:complement(18474986..18476398)
AA seq 258 aa
MAATGAGEGKETAAVAGGGGGGSLHSKTLLKSEPLYQYVLESTVFPREPDCLRELRLATA
NHPMAVMAASPDQVQLFGLLIELISAKNAIEVGVFTGYSLLATALALPDDGKIVAIDVSR
ESYDEVGAPVIDKAGVAHKVDFRVGLAMPVLDELVAEEGNKGRFDFAFVDADKVNFLGYH
ERLLQLVRVGGLIAYDNTLWGGSVAAPPAAADEAVPSGRDRSLAALAREFNAAIAADRRV
KPCQLAIADGVMLCRRVA
NT seq 777 nt   +upstreamnt  +downstreamnt
atggcggccaccggcgctggagaaggcaaggagacggccgccgtcgccggcggcggcggc
ggaggtagcctgcacagtaagaccctcctcaagagcgagccgctctaccagtacgtgctg
gagtccaccgtgttcccgcgcgagcccgactgcctgcgcgagctccgcctcgccaccgcc
aatcaccccatggcggtcatggcggcctcgccggatcaggtgcagctgttcggccttctg
atcgagctgatcagcgccaagaacgccatcgaggtcggcgtgttcaccgggtactcgctg
ctcgccaccgccctcgcgctccctgacgacggcaagatcgtggccatcgacgtgagccgg
gagagctacgacgaggtcggagcgccggtgatcgacaaggccggcgtggcgcacaaggtc
gacttccgcgtcggcctcgccatgccggtgctcgacgagctcgtcgccgaggaggggaac
aaggggaggttcgacttcgcgttcgtggacgcggacaaggtgaacttcctcggctaccac
gagcggctgctgcagctggtcagggtcggcggcctcatcgcctacgacaacacgctgtgg
ggcggctcggtggcggcgccgccggcggcggccgacgaggcggtgccgtcggggcgggac
cgctcgctcgccgcgctcgccagggagttcaacgcggcgatcgccgccgaccgccgcgtc
aagccgtgccagctcgccatcgccgacggcgtcatgctctgccgccgcgtggcctga

DBGET integrated database retrieval system