KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4340263
Entry
4340263           CDS       T01015                                 
Name
(RefSeq) zinc finger CCCH domain-containing protein 40
  KO
K12872  pre-mRNA-splicing factor RBM22/SLT11
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    4340263
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:osa03041]
    4340263
Spliceosome [BR:osa03041]
 Complex B
  Other components
   Prp19-related factors
    4340263
 Complex C
    4340263
SSDB
Motif
Pfam: RRM_1 Torus zf_CCCH_4 zf-CCCH_2 zf-CCCH_3 RRM_occluded RRM_3 zf-CCCH zf-CCCH_4 MafB19-deam
Other DBs
NCBI-GeneID: 4340263
NCBI-ProteinID: XP_015643850
UniProt: Q5SNN4
LinkDB
Position
6:complement(3536737..3540232)
AA seq 482 aa
MAHRLLRDAQADGWERSDFPIICESCLGDNPYVRMLRAEYDKECKICARPFTVFRWRPGR
DARYKKTEICQTCCKLKNVCQVCLLDLEYGLPVQVRDTALAINSNDAIPRSDVNREYFAE
EHDRKARAGIDYDSSHGKARPNDTILKLQRTAPYYKRNRAHVCSFYVRGECTRGAECPYR
HEMPETGELSQQNIKDRYYGVNDPVALKLLGKAGEMPSLTPPDDESIRTLYIGGLNNRIT
EQDLRDQFYAHGEIESIRMVLQRACAFVTYTTREGAEKAAEELANKLVIKGIRLKLMWGK
PQAPKPEDDEAGRQGHVAHGGMLPRAVISQQQSGDQPQPPGMEGQQQAPSGSYYFNIPAP
PGAERTLYPSMDPQRMGALVKSQEGDGKPGPQQAAQAQASSSSGQSYPMPPQYYHGQYPP
YYPPYGGYMPPPRMPYPPPPQYPPYQPMLATPAQSQASSSQQPAPATLHQAQVPPPQQTT
QN
NT seq 1449 nt   +upstreamnt  +downstreamnt
atggctcaccggctgctgcgagacgcgcaggcggacgggtgggagcggtccgacttcccc
atcatctgcgagtcctgcctcggcgacaacccctacgtccgcatgttgagagcagaatat
gataaagagtgcaaaatatgtgcacgtccgtttactgtcttccgttggcgacctggccgg
gatgcaagatacaagaagacagagatctgccagacatgttgcaaactgaaaaatgtctgc
caggtctgcctgctagatcttgaatatggtctaccggtccaggttagggatacagcactc
gctattaattcaaatgatgcaatcccaaggagtgatgtgaaccgtgagtactttgcagaa
gagcatgatcgcaaggccagggctggaatagattatgattcttcccatgggaaggcacgt
cccaatgacaccattctgaagcttcagaggacggcaccatattacaagaggaatcgagct
catgtctgcagtttctatgtgcgtggtgaatgtacaagaggtgctgaatgcccttatcga
catgagatgcctgaaactggagagttatctcagcagaacattaaagatcgttactatgga
gttaatgatccagttgctttgaaacttttgggtaaggccggtgagatgccatccctgaca
cctccagacgatgagagtataaggacactttacattggtggccttaataatcgaatcacc
gagcaggatttgagggatcaattttacgcacatggtgaaattgagtccataaggatggtt
ctgcaacgtgcctgtgcatttgtgacgtacactacaagagaaggtgctgagaaagctgca
gaggagcttgccaacaagttagtcatcaagggtatacgcctgaagctcatgtggggtaag
cctcaagcaccaaagccagaagacgatgaagctggaaggcaagggcatgttgcacatgga
ggaatgctccccagggctgttatatctcagcagcagagtggtgaccagcctcaaccacct
ggaatggagggacaacagcaagcaccatcgggatcatactacttcaacattccagcaccg
ccaggagcagagcggacactgtacccttcaatggatccccagaggatgggtgccttggtc
aagtcacaggagggtgatggcaaacccggtccacagcaggcagcccaagctcaggcatca
agcagctcaggacagagttaccctatgccaccacaatattaccatggtcagtacccaccc
tactacccaccgtatggcggttacatgcccccacctcgcatgccatacccaccgccaccg
cagtatccgccttatcagccgatgttggcaacaccagcacagtcgcaagctagctcatca
caacaacctgcaccagcaacgctgcaccaggctcaagtccctcctccgcagcagacgacc
cagaactga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4342926
Entry
4342926           CDS       T01015                                 
Name
(RefSeq) zinc finger CCCH domain-containing protein 49
  KO
K12872  pre-mRNA-splicing factor RBM22/SLT11
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    4342926
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:osa03041]
    4342926
Spliceosome [BR:osa03041]
 Complex B
  Other components
   Prp19-related factors
    4342926
 Complex C
    4342926
SSDB
Motif
Pfam: RRM_1 Torus zf_CCCH_4 zf-CCCH_2 zf-CCCH_3 zf-CCCH RRM_occluded RRM_3 zf-CCCH_4
Other DBs
NCBI-GeneID: 4342926
NCBI-ProteinID: XP_015644715
UniProt: Q6Z358
LinkDB
Position
7:complement(10678659..10683106)
AA seq 486 aa
MAHRLLRDAQADGWERSDFPIICESCLGDNPYVRMLRAEYDKECKICARPFTVFRWRPGR
DARYKKTEICQTCCKLKNVCQVCLLDLEYGLPVQVRDTALSTNSNDAIPRSDVNREYFAE
EHDRRARAGIDYDSSNGKARANDTILKLQRTAPYYKRNRAHVCSFYVRGECTRGAECPYR
HEMPETGELSQQNIKDRYYGVNDPVALKLLSKAGEMPSLTPPDDESIRTLYIGGLDSRVT
EQDLRDQFYAHGEIETIRMVLQRACAFVTYTTREGAEKAAEELANKLVIKGVRLKLMWGK
PQAPKPEEDEAGRQGHVAHGGMLPRAVISQQQSGDQPQPPGMEGQQQPASASYYFNIPAP
PAAERTLYPSMDPQRMGALVESQEGDGKPGPQQAGQGQASSSSGQSYPEPPPPYYHGGQY
PPYYPPYGGYMPPPRMPYQQPPQYPAYQPMLAPPAQSQASSLQQPAPATQQLGQGPQQQT
TQNGMT
NT seq 1461 nt   +upstreamnt  +downstreamnt
atggcccaccggctgctgcgggacgcgcaggcggacgggtgggagcgttccgacttcccc
atcatctgcgagtcctgcctcggcgacaacccctacgttcgcatgttaagagcagaatac
gataaagagtgcaaaatatgtgcacgtccttttactgtcttccgttggcgacctggccgg
gatgcaaggtacaagaagacagagatctgccagacttgttgcaaactgaaaaatgtctgc
caggtctgccttctagatcttgaatatggtctgccggtccaggtcagggatacagcactt
tctactaattcaaacgatgcaatcccaaggagtgacgtgaaccgcgagtactttgcagaa
gagcatgatcgcagggccagagctggaattgattatgactcttccaatggtaaggcacgt
gccaacgacaccattctgaaactccagagaacagcgccatattacaagaggaatcgagcc
catgtctgtagtttctatgtgcgtggtgaatgtacaagaggtgctgaatgcccttatcga
catgagatgcctgaaactggagagttatctcagcagaacatcaaagatcgttactacgga
gttaacgatccagttgctttgaagcttttgagtaaggctggtgagatgccatccctgaca
cccccagatgatgagagtataaggacactttacattggtggccttgatagtcgagtcact
gagcaggatttgagggatcaattttatgcccatggtgagattgagaccataagaatggtt
ctgcagcgtgcttgtgcatttgtgacttacactacaagagaaggtgctgagaaagctgca
gaggagctcgctaacaagttagtcatcaagggtgtgcgtctgaagctcatgtggggcaag
cctcaagcaccaaaaccggaggaagatgaagctgggaggcaagggcatgttgcacatgga
ggaatgctccctagggctgtaatatctcagcagcagagtggtgaccagcctcaacctcct
gggatggaaggccagcagcaacctgcttcggcatcatactacttcaacattccagcaccg
ccagcggcagagcggacactgtacccttcgatggatccccagaggatgggtgccttggtc
gagtcacaggagggcgatggcaaaccaggtccacagcaggctgggcaaggtcaggcatca
agcagctcaggacagagttatcctgagccgccaccaccatattaccatggtggtcagtat
cccccctactatccaccttatggcggttacatgcccccacctcgcatgccataccagcag
ccaccacagtacccagcttatcaacctatgctggcaccaccagcacagtcgcaagctagc
tcattgcaacaaccagcaccggcaacgcagcagctgggtcaaggccctcagcaacagaca
acccagaacggaatgacttaa

DBGET integrated database retrieval system