KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4340268
Entry
4340268           CDS       T01015                                 
Name
(RefSeq) uncharacterized protein LOC4340268
  KO
K10842  CDK-activating kinase assembly factor MAT1
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03022  Basal transcription factors
osa03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    4340268
  09124 Replication and repair
   03420 Nucleotide excision repair
    4340268
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:osa03021]
    4340268
   03400 DNA repair and recombination proteins [BR:osa03400]
    4340268
Transcription machinery [BR:osa03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     4340268
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TFIIH complex
     4340268
SSDB
Motif
Pfam: MAT1 NAD_binding_9
Other DBs
NCBI-GeneID: 4340268
NCBI-ProteinID: XP_015643674
UniProt: B9FRR5 Q5SNL8
LinkDB
Position
6:3596006..3598325
AA seq 195 aa
MVVASGGGRNAWAKEMTIRRRITSIFNKTREHFPSLKDYNDYLEEVEDMTFNLIEGIDVE
VIEAKIARYQQENAEQIYLSRAKRAEDLAAALKASRMNPGKAGANDTAAGSSQGISSGAG
VQEGQYAPAAVPGGLAQPRPTGMAPQPIGGSSVPLQGDDEETMRLRAESGARAGGWSIEM
CKRRALQEAFSTIFV
NT seq 588 nt   +upstreamnt  +downstreamnt
atggtggtggcatccggtggagggcggaacgcgtgggcgaaggagatgaccatccgccgc
aggattaccagcatattcaacaagacgcgggagcattttccgtccctgaaagattacaac
gactatcttgaggaagtcgaggatatgactttcaacctgatcgaggggatagatgtcgag
gtgattgaagctaaaattgccagatatcaacaggaaaatgctgaacagatatatttgtcc
cgggctaaaagggccgaagatcttgctgccgcacttaaagcaagcagaatgaaccctggc
aaggctggtgccaatgacacggctgctggaagctctcagggcattagtagtggcgcggga
gttcaggaaggccagtatgcgcctgctgctgttcccggtgggctagctcagcctcggcca
acagggatggcccctcaaccgatcggcggttcatcggttcctcttcaaggagatgatgag
gagaccatgaggctacgtgcggagagcggggctcgagctggtggatggtccatcgaaatg
tgcaagagaagagcattgcaggaagcgttcagtaccatattcgtctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4350497
Entry
4350497           CDS       T01015                                 
Name
(RefSeq) uncharacterized protein LOC4350497
  KO
K10842  CDK-activating kinase assembly factor MAT1
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03022  Basal transcription factors
osa03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    4350497
  09124 Replication and repair
   03420 Nucleotide excision repair
    4350497
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:osa03021]
    4350497
   03400 DNA repair and recombination proteins [BR:osa03400]
    4350497
Transcription machinery [BR:osa03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     4350497
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TFIIH complex
     4350497
SSDB
Motif
Pfam: MAT1
Other DBs
NCBI-GeneID: 4350497
NCBI-ProteinID: XP_015617666
UniProt: A0A8J8Y0U0 Q2R4I6
LinkDB
Position
11:complement(16309603..16312136)
AA seq 195 aa
MVVVSSGGGGGGNAWAKEMTIRRRMASIFNKTQDHFSCLKDYNDYLEEVEDMTFNLIEGI
DVEEIEAKIARYQQENAEQIYLSRAKRAEDLAAALKASRMNPGKAAASDTAAGSSQGISS
SAGVQGQYAPAAVGMSQPRPTGMAPQPIGGSSDPLQGDDEETMRLRAERGARAGGWTIEM
GKRRALEEAFSSIFI
NT seq 588 nt   +upstreamnt  +downstreamnt
atggtggtggtgtctagcggcggcggcggcggggggaacgcgtgggcgaaggagatgacc
atccgccgcaggatggccagcatattcaacaagacgcaggaccatttctcgtgtctgaaa
gactacaacgattatctagaagaggttgaggatatgactttcaacctgattgaggggata
gatgtcgaggagattgaagctaagattgccaggtaccagcaggaaaatgctgaacagata
tacttgtcccgggctaaaagggctgaagatcttgccgccgcacttaaagcaagcagaatg
aaccctggaaaggctgctgccagtgacacggctgctggaagctcccagggcattagcagc
agcgcaggagttcagggccagtatgcgcctgctgctgttgggatgtctcagccccggccg
acaggtatggccccccaaccaatcggcggttcatcggatccacttcagggagacgatgag
gagaccatgagattacgagcagagcgaggagctcgagcaggtggatggactatcgaaatg
ggcaagagaagagcactagaggaagcgttcagcagcatattcatctga

DBGET integrated database retrieval system