KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4340273
Entry
4340273           CDS       T01015                                 
Name
(RefSeq) 40S ribosomal protein S30
  KO
K02983  small subunit ribosomal protein S30e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4340273
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4340273
   04121 Ubiquitin system [BR:osa04121]
    4340273
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Small subunit
    4340273
  Archaea
    4340273
Ubiquitin system [BR:osa04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitin-like proteins (UBLs)
   4340273
SSDB
Motif
Pfam: Ribosomal_S30
Other DBs
NCBI-GeneID: 4340273
NCBI-ProteinID: XP_015644441
UniProt: Q69SI5 Q6K853
LinkDB
Position
6:3656423..3657102
AA seq 62 aa
MGKVHGSLARAGKVRGQTPKVAKQDKKKKPRGRAHKRMQYNRRFVTAVVGFGKKRGPNSS
EK
NT seq 189 nt   +upstreamnt  +downstreamnt
atgggtaaggtgcacggatcgctcgctcgcgccgggaaggtgcgcggccagacgcccaag
gtggcgaagcaggacaagaagaagaagccccgcggccgcgcccacaagaggatgcagtac
aaccgccgcttcgtcaccgccgtcgtcggattcggcaagaagcgcgggcccaactcctcc
gagaagtag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9272265
Entry
9272265           CDS       T01015                                 
Name
(RefSeq) 40S ribosomal protein S30
  KO
K02983  small subunit ribosomal protein S30e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    9272265
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    9272265
   04121 Ubiquitin system [BR:osa04121]
    9272265
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Small subunit
    9272265
  Archaea
    9272265
Ubiquitin system [BR:osa04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitin-like proteins (UBLs)
   9272265
SSDB
Motif
Pfam: Ribosomal_S30
Other DBs
NCBI-GeneID: 9272265
NCBI-ProteinID: XP_015623731
UniProt: Q69SI5 Q6K853
LinkDB
Position
2:complement(34295895..34296524)
AA seq 62 aa
MGKVHGSLARAGKVRGQTPKVAKQDKKKKPRGRAHKRMQYNRRFVTAVVGFGKKRGPNSS
EK
NT seq 189 nt   +upstreamnt  +downstreamnt
atgggtaaggttcacggctcgctggctcgcgccgggaaggtgagggggcagacgccgaag
gtggcgaagcaggacaagaagaagaagccccggggccgcgcccacaagcggatgcagtac
aaccgccgtttcgtcaccgccgtcgtcggcttcggcaagaagcgcgggccaaactcctcc
gagaagtag

DBGET integrated database retrieval system