KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4340333
Entry
4340333           CDS       T01015                                 
Name
(RefSeq) shikimate O-hydroxycinnamoyltransferase
  KO
K13065  shikimate O-hydroxycinnamoyltransferase [EC:2.3.1.133]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00940  Phenylpropanoid biosynthesis
osa00941  Flavonoid biosynthesis
osa00945  Stilbenoid, diarylheptanoid and gingerol biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00039  Monolignol biosynthesis, phenylalanine/tyrosine => monolignol
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00940 Phenylpropanoid biosynthesis
    4340333
   00945 Stilbenoid, diarylheptanoid and gingerol biosynthesis
    4340333
   00941 Flavonoid biosynthesis
    4340333
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.133  shikimate O-hydroxycinnamoyltransferase
     4340333
SSDB
Motif
Pfam: Transferase
Other DBs
NCBI-GeneID: 4340333
NCBI-ProteinID: XP_015643300
UniProt: Q5SMM8 A0A1L2EH66
LinkDB
Position
6:4268759..4270840
AA seq 445 aa
MAVEIVKSSMVTAGEATPEHRIWLSNLDLLVARSHTPTVYVYRRTGPDSDAAFFSPDVLK
AALSKVLVPFYPLAGRLAQDSAGRPEISCTGEGVLFVTARSGATIDDLGDLAPSDELRRM
LVPAADVAAASILAMFQVTFFRCGGVCLGAAIHHTAADGLAALDFVNTWAAIARDVAGDG
EAAAAAVQRPWLDRTLLRARSPPAVRFDHAEYSRRRGGGSKLPFDSAILPMSKNQLNALK
GAGAGAGKRLSTFTAVVAHVWRCACKARGLAVAGTEAATRLYMTADARTRLHPPLPRGYL
GNAIFRASAVSKVSDIVAAGPLGAVAEKVSAATARLDDGYVRSLLDHLEQTAAAASGGAA
GLRKGEWVMPESDLWVISWQGLPLYDADFGWGRPAFMGRACLQFSGLVYLVPGRDDGDGR
LDVVVAMDPESLAKFKDVFYEELKC
NT seq 1338 nt   +upstreamnt  +downstreamnt
atggcagtggagatcgtcaagtcctccatggtgacggccggcgaggcgacgccggagcac
aggatatggctctccaacctcgacctgctggtggccaggagccacacccccaccgtctac
gtctaccggcgaactggccccgactccgacgcggcgtttttctcgccggacgtcctcaag
gccgccctgtccaaggtgctcgtccccttctaccccctcgccggccgcctcgctcaggac
agcgccggcaggccggagatcagctgcaccggcgagggcgtgctcttcgtcacggcgcgg
agtggcgccaccattgacgacctgggcgacctcgccccgtcggacgagctccggcggatg
cttgtcccggcggccgatgtcgccgctgccagcatcttggccatgttccaggtgacgttc
tttaggtgtggaggggtgtgcctgggcgcggcgatccatcacacggcggcggacggcctc
gcggcgctggacttcgtcaacacgtgggccgccattgcgagggacgtcgccggcgacggc
gaggcggcggcggcggcggtgcagcggccgtggctcgaccgcacgctcctccgcgcgcgc
tcccctcccgccgtgcgcttcgaccacgccgagtactcccgtcgccgcggcggcggttca
aagctgccgttcgactcggccatcctccccatgtccaagaaccagctcaacgcgctcaag
ggcgccggcgccggcgccggcaagaggctgtccacttttacggcggtggtcgcgcacgtg
tggcggtgcgcgtgcaaggcgcgcgggctcgccgtcgccggaacggaggcggcgacgagg
ctgtacatgaccgccgacgcgcgcacccgcctgcacccgccgctcccgcgcggctacctc
ggcaacgccatcttccgcgcgtcggcggtgtccaaggtgagcgacatcgtcgccgccggg
ccgctcggcgccgtcgcggagaaggtgtccgccgccaccgcgcggctcgacgacggctac
gtccggtcgctgctggaccacctggagcagacggcggcggcggcgagcggcggcgcggcg
gggctccgcaagggggagtgggtgatgccggagagtgacctgtgggtgatcagctggcag
gggctgccgctctacgacgccgacttcggctgggggcggccggcgttcatggggcgtgcg
tgcctccagttcagcggcctcgtctacctcgtgccaggccgagacgacggcgacggccgg
ctcgacgtcgtcgtggccatggaccccgagagccttgccaagttcaaggatgtgttctat
gaggagctcaagtgttag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4346205
Entry
4346205           CDS       T01015                                 
Name
(RefSeq) shikimate O-hydroxycinnamoyltransferase isoform X1
  KO
K13065  shikimate O-hydroxycinnamoyltransferase [EC:2.3.1.133]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00940  Phenylpropanoid biosynthesis
osa00941  Flavonoid biosynthesis
osa00945  Stilbenoid, diarylheptanoid and gingerol biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00039  Monolignol biosynthesis, phenylalanine/tyrosine => monolignol
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00940 Phenylpropanoid biosynthesis
    4346205
   00945 Stilbenoid, diarylheptanoid and gingerol biosynthesis
    4346205
   00941 Flavonoid biosynthesis
    4346205
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.133  shikimate O-hydroxycinnamoyltransferase
     4346205
SSDB
Motif
Pfam: Transferase
Other DBs
NCBI-GeneID: 4346205
NCBI-ProteinID: XP_015648074
LinkDB
Position
8:27202214..27204914
AA seq 450 aa
MESCFVTPHEDTPETIEEEVKEMESCFVTPHEDTPRQGLWLSPLDIVMVSRGHTPTVYFY
QRDTATVAADFFEVGRLKEAMAKALVAFYPLAGRLSVDGDGRPEIDCNAEGALFVVAQSK
LTVDAFSDLKPSPELRRLFAPRIEPASIMLGVQVHINYSLQVTFLSCGGVALGTVLHHVA
IDALSAFHFFQTWSSFCRDGEAAMLELPCHERTLLRTRSPPIVHPDVHSMFSLKLNFCEP
SDPISTKIFVISKNQLDALKQICGGLSTFCAMSALVWQCMCIARQLPLDAETRVIFPVNI
RRRVKPPLPDRYFGNALVDLKVASTVRDIVLGTLDVTAAQIKNALGRLDDEMLQSAIDYN
EMAGMPNKHTKGNLPDTELRMVSWLGMPVYDADFGWGKPEMMSRAESVRGGFVYMMDGID
NDGGGVRVLMCMEARKMEEFERLFYAKFAQ
NT seq 1353 nt   +upstreamnt  +downstreamnt
atggagtcatgttttgtaacgccccacgaggacacgccagagacgatagaagaagaggtg
aaagagatggagtcttgttttgtaacgccccacgaggacacgccaaggcaagggctctgg
ctctctcccctcgacatagtcatggtcagcagaggccatacccctactgtgtacttctac
caacgtgacactgccactgttgctgccgattttttcgaggtaggcaggcttaaggaggct
atggcaaaggccctagtggccttctaccccttggcaggccgtctcagtgtagatggtgat
ggtaggcctgaaattgactgcaatgccgagggtgcgctctttgttgtggctcagtcaaaa
ctcaccgttgatgccttcagcgaccttaagccatcaccagagttgaggaggttgtttgcc
ccccgtattgagccagcatccatcatgcttggagtacaggtgcacattaattattccttg
caggtgactttcttgagttgtggtggtgtggcattagggacggtgttgcaccatgtcgcc
atcgatgcccttagcgcgttccatttcttccagacatggtcttctttctgccgagatggt
gaagccgccatgttggagctgccctgccatgaacgcaccctcctccgcacacgctcccca
cctatcgtccacccggatgtgcactcaatgttcagtctaaagctcaacttctgtgagcca
tcagaccctatatccaccaagatattcgtcatctccaagaaccagctcgatgcccttaaa
caaatatgtggtggattgagcacattttgtgccatgagcgcccttgtatggcagtgcatg
tgcattgctcggcaactccctctagacgccgagacacgcgtcatcttcccagtcaacatt
cggcgccgtgtgaagccacctctcccagatcgctacttcggcaatgcacttgtcgacttg
aaagtagcctccacagttagggacattgtcttggggacactggatgtaactgctgcccag
ataaagaacgcattgggacgccttgacgatgagatgctgcagtcggcgatagactacaat
gagatggcagggatgcccaacaagcataccaagggaaacctgccagatacagaattacga
atggtctcttggctaggcatgccagtttatgatgcggattttgggtgggggaagccggag
atgatgtctcgtgcggagtctgtgcgtggcggatttgtttatatgatggatggcattgac
aacgatgggggtggcgtgcgtgtgctcatgtgtatggaggcacgaaagatggaggagttc
gagcgactgttttatgccaagtttgcacaatga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4347092
Entry
4347092           CDS       T01015                                 
Name
(RefSeq) shikimate O-hydroxycinnamoyltransferase
  KO
K13065  shikimate O-hydroxycinnamoyltransferase [EC:2.3.1.133]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00940  Phenylpropanoid biosynthesis
osa00941  Flavonoid biosynthesis
osa00945  Stilbenoid, diarylheptanoid and gingerol biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00039  Monolignol biosynthesis, phenylalanine/tyrosine => monolignol
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00940 Phenylpropanoid biosynthesis
    4347092
   00945 Stilbenoid, diarylheptanoid and gingerol biosynthesis
    4347092
   00941 Flavonoid biosynthesis
    4347092
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.133  shikimate O-hydroxycinnamoyltransferase
     4347092
SSDB
Motif
Pfam: Transferase WES_acyltransf
Other DBs
NCBI-GeneID: 4347092
NCBI-ProteinID: XP_015611953
UniProt: Q69P55 A0A0P0XLX4
LinkDB
Position
9:complement(15251991..15256367)
AA seq 440 aa
MKVEVVETTLVAPSEATPQHALWLSNLDLAVPKTHTPLVYYYPAPSPPPADAGAEAEAEG
FFAPERLREALARALVPFYPLAGRLAAGPGGRLEIDCNGEGALFVVARADFTGDEMFTDF
EPSPEARRLLVPFAASGEPPCVLAMVQVTFLKCGGVAVGTGMHHVTMDGAGAFQFIRTWT
GLSRGLDAAAASPSPPSHDRTLLRARSPPHVPFEHPVYSPSYLNGLPRPFVTRVYSVPPK
LLADIKAACAPGVSTYGAVTAHLWRAMCVARGLPHDAESRLRVPANIRQRVRPPLPSPYF
GNAIVRDLVTVPVRDILSQPLGFVAERIKHAVARVDDAFVRSVIDFLELESEKGNQAARG
QFMPETDLWVVSWLGMPIYDADFGWGRPAFVAPAQMFGSGTAYVTQAPDKDDGSGGGVSV
LFALEPEYIQCFEKAFYGTE
NT seq 1323 nt   +upstreamnt  +downstreamnt
atgaaggtggaggtggtggagacgacgctggtggcgccgagcgaggcgacgccgcagcac
gcgctgtggctctccaacctcgacctcgccgtgcccaagacgcacaccccgctggtctac
tactaccccgcgccctcgccgccgccggcggatgcgggggcggaggcggaggcggagggg
ttcttcgcaccggagaggctgcgggaggcgctggcgagggcgctggtgccgttctacccg
ctggcggggcggctggcggcggggcccggcggccggctcgagatcgactgcaacggcgag
ggggcgctgttcgtcgtcgccagggccgacttcaccggcgacgagatgttcaccgacttc
gagccctcccccgaggcccgccgcctcctcgtccccttcgccgcctccggcgagcccccc
tgcgtcctcgccatggtccaggtgacgttcctgaagtgtggaggcgtggccgtcggcacg
ggcatgcaccatgtcacgatggacggcgcgggcgcgttccagttcatccggacgtggacg
gggctgtcgcgtgggctcgacgccgcggccgcgtcgccgtcgccgccgtcgcacgaccgc
accctcctccgggcgcgctcgccgccgcacgtcccgttcgagcacccggtgtactccccg
agctacctcaacgggctgccgcggccgttcgtgacccgcgtctactccgtcccgcccaag
ctcctcgccgacatcaaggccgcctgcgcccccggcgtgtccacgtacggcgcggtgacc
gcgcacctgtggcgcgccatgtgcgtcgcccgggggctcccccacgacgccgagtcgcgg
ctgcgcgtcccggccaacatccggcagcgcgtccgcccgccgctcccgtcgccctacttc
ggcaacgccatcgtgcgcgacctcgtcacggtgcccgtccgcgacatcctgtcgcagccg
ctggggttcgtggcggagcggatcaagcacgcggtggcgcgcgtggacgacgcgttcgtc
cgctcggtgatcgacttcctggagctggagtccgagaaggggaaccaggcggcgcgcggg
cagttcatgccggagacggacctgtgggtggtgagctggctcgggatgcccatctacgac
gccgacttcgggtgggggcgcccggcgttcgtggcgccggcgcagatgttcggcagcggc
acggcgtacgtgacgcaggcgccggacaaggacgacggcagcggcggcggcgtgtccgtg
ctgttcgcgctcgaaccggagtacatccagtgctttgagaaggccttctacggcacagag
tga

DBGET integrated database retrieval system