KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4340478
Entry
4340478           CDS       T01015                                 
Name
(RefSeq) alternative NAD(P)H-ubiquinone oxidoreductase C1, chloroplastic/mitochondrial isoform X1
  KO
K17872  demethylphylloquinone reductase [EC:1.6.5.12]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00130  Ubiquinone and other terpenoid-quinone biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01240  Biosynthesis of cofactors
Module
osa_M00932  Phylloquinone biosynthesis, chorismate (+ phytyl-PP) => phylloquinol
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    4340478
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.12  demethylphylloquinone reductase
     4340478
SSDB
Motif
Pfam: Abhydrolase_3 Pyr_redox_2 BD-FAE COesterase Pyr_redox Esterase_PHB NAD_binding_8
Other DBs
NCBI-GeneID: 4340478
NCBI-ProteinID: XP_015643324
LinkDB
Position
6:complement(5837370..5844648)
AA seq 877 aa
MSCRAAPWGRPSLPGGRPSPGSARQRGPFGGLNVWRNSILNNSWRLGGTPMKFGLPSRLF
RLMASSSSGDGGFSRPSSTDEGPMPIYSWPDKQRPRVCILGGGFGGLYTALRLESLVWPN
DKKPQVMLVDQSDRFVFKPMLYELLSGEVDVWEIAPSFTELLKNTSVQFVKDSVKLLRPS
DHFRRDSGGSCTGGVVHLESGTVIEYDWLVLALGAEAKIDVVPGSAEYAIPFTTLDDALK
VESQLKMLERRRFGKNSPDIQVAIVGLGYSGVELAATISERLKNKGIVQAINVQTTICPS
APPGNRDAALKVLESRNIQLFLGYFVNCIREASASEDSSSMVTDAKEVNGDHKKLLLELQ
PAQRGIQSQVLEADMVLWTVGSTSQIPRLQPPDAPYVIPLNGRGQVETEETLQVKGHPRT
FAIGDSAALRDPSGKLLPATAQVAFQQADFAGWNLWAAINDRPLLPFRFQNLGEMMTLGR
SDAAITASFIEGLTLEGPLGHAARKIVYCLRMPTDEHRVKVGISWFTKTAVDSLASLQNA
VANSFPSPDPATNRSPSAMDPDSEVAFDFQPYLCQYKSGRVFRLGGDPTVPAGTDPVTRV
VSRDIHAGAARARVYLPPGAAVSTEKLPVVVYFHGGGFVTGSPARPSTHAYLNDLVARAG
AIGVSVYYRLAPENPLPAAYEDAWAAVRWAATRGDGADPWLLDHADLSRLFLAGCSAGAN
IAHNMAVRCGGGGALPDGVTLRGLVVVHPYFTGKEAVGAEAAFGPDVREFFDRTWRFVFP
ETSGLDDPRVNPFVDDATRAAAAAIPCERVQVCVAEQDVLLKERGLWYHRELKASGYGGE
VELFESKGVGHAFHFVGMAGSDQAVELLERNVEFIKK
NT seq 2634 nt   +upstreamnt  +downstreamnt
atgagctgccgcgcggcgccgtgggggcgcccgtcgctccccggcggccggccctccccc
ggctcggcgcggcaacgcggtccattcggaggtttgaatgtatggaggaattcaatcctc
aacaattcatggaggcttggtggtacgccaatgaagtttggactaccatctagattgttc
agactcatggcttcaagtagctcaggagatggtggtttttcacggccttcatcaactgat
gaagggccaatgccaatatactcttggccggataagcagcgtccacgagtgtgcatcttg
ggtggtggatttggtggcctgtacactgctcttagattagaatctcttgtatggcccaat
gataagaagcctcaggtcatgctggttgatcaatctgacagatttgtatttaagcccatg
ttgtatgagctcttgtcaggagaagtggatgtttgggagatagctccatcatttacagag
ttactgaagaacactagtgttcaattcgtgaaggatagtgtaaagcttctgcgcccttct
gatcactttagaagagattctggaggatcatgcactggtggagttgttcatctggaaagt
ggcaccgttattgaatatgattggctcgttctagctttaggggctgaagctaaaattgat
gttgtcccaggatctgctgaatatgcaattcctttcacgactttggatgatgctttgaaa
gttgaaagccagctgaaaatgttggaaaggagaaggtttggtaaaaattcccccgatatt
caggtggccattgtgggattgggttactctggtgtagagttagctgctactatctctgag
agactaaagaacaaagggattgttcaagccatcaatgttcagacaactatctgtcccagt
gcaccacctggaaaccgcgacgctgctctgaaggttcttgaatctcgaaatattcaactt
ttcttgggatattttgtgaactgcatcagagaagcttctgcatctgaggattcaagtagc
atggttacagatgcaaaagaagttaatggtgaccataagaaactactattggaacttcaa
cctgctcaaaggggcatccagagccaggttctggaggctgatatggtattatggacagtg
ggttcaacctctcagattcctcggttacagcctccagatgctccatatgttattccttta
aatggtcggggccaggtagagactgaggaaacccttcaggtaaaaggccatcctcgaact
tttgcaatcggtgattcagcagctctaagagacccatcaggcaaacttctcccagccact
gcacaggttgcttttcaacaagcagattttgctggatggaatctctgggcagcaatcaat
gaccgacctcttctgccattcaggtttcaaaatcttggtgagatgatgacacttggtaga
agtgatgctgcgataacagcaagctttattgagggcctgaccttggaaggacctttaggg
catgctgctaggaagattgtatactgccttaggatgcccacagatgaacatcgagtgaag
gttggaatcagttggttcacaaagactgcagttgattcacttgcctccctgcaaaacgca
gtggccaactcatttccgtctcccgatccggccaccaaccgctccccatccgccatggat
cccgactccgaggtcgccttcgacttccagccctacctctgccagtacaagagcggccgc
gtcttccgcctcggcggcgaccccaccgtccccgccggcaccgaccccgtcacccgcgtc
gtctcccgcgacatccacgccggcgccgccagggcgcgcgtctacctcccgcccggcgcc
gccgtgtccaccgagaagctccccgtcgtggtgtacttccatggcggcgggttcgtcacc
ggctcgcccgccaggccgagcacccacgcctacctcaacgatctcgtggcccgggccggc
gcgattggggtgtccgtgtactaccgcctcgcgccggagaacccgctcccggcggcgtac
gaggacgcgtgggcggccgtgcggtgggcggcgacgcgcggggacggcgccgacccgtgg
ctgctcgaccacgccgacctctcccgcctgttcctcgccggctgcagcgccggcgccaac
atcgcccacaacatggccgtccgctgcggcggcggcggcgcgctcccggacggggtgacc
ctccgcggcctcgtggtggtccacccctacttcaccggcaaggaggccgtgggcgccgag
gcggcgttcggcccggacgtccgcgagttcttcgaccggacatggcggttcgtgttcccg
gagacgtccgggctggacgacccgcgcgtgaacccgttcgtcgacgacgcgacgcgcgcc
gccgccgccgcgatcccgtgcgagcgcgtgcaggtgtgcgtggccgagcaggacgtcctg
ctcaaggagcgggggctgtggtaccaccgggagctcaaggcgagcggctatggcggcgag
gtggagctgttcgagtccaagggcgtcggccacgcgttccacttcgtcggcatggcgggc
tccgaccaggccgtcgagctgctggagcgcaacgtcgaattcatcaagaaatga

DBGET integrated database retrieval system