KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4340610
Entry
4340610           CDS       T01015                                 
Name
(RefSeq) putative DNA glycosylase At3g47830
  KO
K10773  endonuclease III [EC:4.2.99.18]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    4340610
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:osa03400]
    4340610
Enzymes [BR:osa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     4340610
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     4340610
 Prokaryotic type
     4340610
SSDB
Motif
Pfam: HhH-GPD USP47_C HHH_5
Other DBs
NCBI-GeneID: 4340610
NCBI-ProteinID: XP_015641912
UniProt: Q67VC2
LinkDB
Position
6:complement(7169466..7172747)
AA seq 277 aa
MTRKPKRKPPPSPEPYHDHPSPSPAQCLAVRDALLAFHGFPDEFAPFRRRRRRLGLDTSP
DPEEDTDGDPSPPPTVLDGLVTTLLSQNTTDAISRRAFAALKAAFPTWDQVVDEEEGKRL
EDAIRCGGLAATKAARIRAMLRGVRERRGKICLEYLRDLSVDEVKTELSRFKGIGPKTVA
CVLMFYLQKDDFPVDTHVLRITNAIGWVPATASRERAYLHLNSKIPDDLKFDLNCLFVTH
GKLCQSCSKKLGGQKTTGSNSMCPLASYCCTEEKMKQ
NT seq 834 nt   +upstreamnt  +downstreamnt
atgacccggaagcccaagcggaagcctccgccctcgccggagccgtaccacgaccacccc
tccccttcccccgcccaatgcctcgccgtccgcgacgccctcctcgccttccacggcttc
cccgacgagttcgcgcccttccgccgccgccgccgccgcctcggcctcgacacatccccg
gacccggaggaggacacggatggcgatccgtctccgccgcccaccgtcctcgacggcctc
gtcacgaccctcctctctcagaacaccaccgacgccatctcgcgccgcgccttcgccgcc
ctcaaggccgcgttccccacctgggaccaggtggtggatgaggaggaggggaagaggctg
gaggacgccatccggtgcggggggcttgcggcgacgaaggcggcgaggataagggcgatg
ctgaggggcgtccgggagaggcgaggcaagatttgcctcgagtatttgcgggatctgtcc
gtggatgaggtgaagactgagctatctcggttcaaagggatcgggccaaagactgtggcg
tgtgtgctgatgttctatcttcagaaggatgattttccagtagatactcatgtactccgt
attacaaacgctattggttgggttcctgcaacagctagcagagagagggcatatcttcat
ctgaacagcaaaattcctgatgatctaaaatttgatctgaattgtctatttgtaactcat
ggaaagctctgtcaatcatgttccaaaaagttaggaggccagaaaaccaccggttcaaat
tctatgtgccccctagcaagttattgttgcactgaagaaaagatgaagcaatag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9268162
Entry
9268162           CDS       T01015                                 
Name
(RefSeq) endonuclease III homolog 1, chloroplastic isoform X1
  KO
K10773  endonuclease III [EC:4.2.99.18]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    9268162
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:osa03400]
    9268162
Enzymes [BR:osa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     9268162
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     9268162
 Prokaryotic type
     9268162
SSDB
Motif
Pfam: HhH-GPD HHH EndIII_4Fe-2S
Other DBs
NCBI-GeneID: 9268162
NCBI-ProteinID: XP_015617924
LinkDB
Position
11:9187694..9192920
AA seq 421 aa
MQFWEVGQLLCTHFTCLCGLAALPRYICASLQPSHGLQLQEANHNYELGPEELTIRSIKS
KAEAGVNCVDPDGDLPLMVLCSNAWAAFLCLSNEWYAFSGAKEVKRESSVSFDLTKTEAV
ASMRSKNVKRVLEVTGENIKKEVDIVPDIEDFRYGKASPSLVRLEKKVRVSSAIKVGAPE
NWEAILKGIKNMRLSGEAPVDTKGCEKAGSLLPPKERRFAVLISTMMSSQTKDEVTHAAV
ERLSEKGLLDPDAIVRTDEATLANLIKPVGFYQRKAKFIKEASKICLERFGGDIPDSLNE
LLALKGVGPKMAHLVMSIAWKNTQGICVDTHVHRISNRLGWVFREGTKQKTTTPEQTRMS
LEKWLPKDEWEPINPLLVGFGQTICTPLRPKCDMCGINNICPSAFKESSSPNPKQKKMRS
S
NT seq 1266 nt   +upstreamnt  +downstreamnt
atgcagttttgggaggtcggtcaactgttatgcacccatttcacttgtttatgtggttta
gcagcccttcctagatacatttgtgcttcccttcagccctcacatggtctgcaactgcaa
gaggcaaaccacaattacgaattggggccagaggagctcacaataagaagcataaagtcc
aaggcggaggctggagttaactgtgttgaccctgatggagatttaccactcatggttctt
tgctcgaatgcttgggcagctttcctctgtttgagcaacgaatggtatgccttttcaggt
gctaaagaagtgaaacgtgaatccagtgtttcttttgacttgaccaaaactgaagcggtt
gcttccatgagaagcaaaaatgtgaaacgggtgcttgaagtaactggggaaaatattaag
aaagaggttgatatcgttcctgacattgaagattttcgatatggcaaggcatcgccatct
ttagttaggttggagaaaaaggtgagagtttcatctgctataaaagttggagctccagaa
aattgggaggcaatccttaagggtattaaaaacatgaggttatctggcgaggcccctgta
gatacaaagggctgtgaaaaagctggttctcttcttccacccaaggaaaggagattcgca
gttttgatatcaaccatgatgtcaagccaaacaaaagatgaagttacacatgctgctgtt
gaacgtctatctgagaaaggtttacttgatccggatgctattgtccgaacagatgaggcc
acactagcgaatcttatcaaacctgttggattctatcagaggaaggccaaattcataaaa
gaagcttctaaaatttgccttgaacgttttggaggggatattccagattctctgaatgag
cttcttgctctgaaaggagttggtcctaaaatggctcatctggtgatgagcattgcatgg
aagaatactcagggaatttgcgttgacactcatgtacatcgcatatctaaccgtcttggg
tgggttttccgagagggaacaaaacagaaaactacaacacccgagcaaacaagaatgtct
cttgagaagtggctaccaaaggatgagtgggaacctatcaacccattactggttggattt
gggcaaacaatctgtactccacttaggcccaaatgtgacatgtgcggcataaacaacatc
tgcccttcagctttcaaggaatcatcaagcccaaatccaaagcaaaagaaaatgaggtca
tcttag

DBGET integrated database retrieval system