KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4340702
Entry
4340702           CDS       T01015                                 
Name
(RefSeq) acylphosphatase
  KO
K01512  acylphosphatase [EC:3.6.1.7]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00620  Pyruvate metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    4340702
Enzymes [BR:osa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.7  acylphosphatase
     4340702
SSDB
Motif
Pfam: Acylphosphatase
Other DBs
NCBI-GeneID: 4340702
NCBI-ProteinID: XP_015643651
UniProt: Q5Z6P6
LinkDB
Position
6:complement(8744135..8744777)
AA seq 117 aa
MATPAADATSSSPTPSPPPQETPARKAVRVVVKGRVQGVGFRDWTAETAESLGLAGWVRN
RRDGTVEALLSGDPAKVDEMVSRHLPVGSPASAVTAVVPSPADPIHPSLGFEINFTV
NT seq 354 nt   +upstreamnt  +downstreamnt
atggccacgccggcggccgacgccacgtcctcctcgcccacgccatcgccgccgccgcag
gagacaccggcgcgcaaggcggtgcgggtggtggtgaaggggcgggtgcagggggtgggg
ttccgcgactggacggcggagacggcggagtccctcggcctcgccgggtgggtccgcaac
cgccgcgacggcaccgtggaggccctcctctccggcgaccccgccaaggtcgacgagatg
gtctcccgccacctccccgtcggctcccccgcctccgccgtcaccgccgtcgtcccctcc
cccgccgaccccatccacccctccctcggcttcgagatcaacttcaccgtctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4340703
Entry
4340703           CDS       T01015                                 
Name
(RefSeq) acylphosphatase
  KO
K01512  acylphosphatase [EC:3.6.1.7]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00620  Pyruvate metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    4340703
Enzymes [BR:osa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.7  acylphosphatase
     4340703
SSDB
Motif
Pfam: Acylphosphatase
Other DBs
NCBI-GeneID: 4340703
NCBI-ProteinID: XP_015642049
UniProt: Q5Z6P5 A0A5S6R9R0
LinkDB
Position
6:complement(8745271..8746044)
AA seq 129 aa
MFPSATAPRLALTPRSVAAARRAMASAATPQPSPPSPKAVRVVVKGRVQGVFFRDWTVET
ARALGLAGWVRNRRDGTVEALLSGDPARVDEMVSRHLPVGPRAAAVTAVLPSPADPVDPA
EGFTRKPTA
NT seq 390 nt   +upstreamnt  +downstreamnt
atgttcccttccgccaccgcgccacgcctcgccctcaccccgcgctccgtcgccgccgcc
cgccgcgccatggcctccgccgccaccccgcagccaagcccgcccagccccaaggcggtg
cgggttgtggtgaagggccgggtgcagggggtcttcttccgcgactggacggtggagacg
gcgcgcgcgctgggcctcgccggctgggtccgcaaccgccgcgacggcaccgtggaggcc
ctcctctccggcgaccccgccagggtcgacgagatggtgtcccgccacctccccgtcggc
ccccgcgccgccgccgtcaccgccgtcctcccctcccccgccgaccccgtcgaccccgcc
gagggcttcacccgcaagcccaccgcctga

DBGET integrated database retrieval system