KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4340850
Entry
4340850           CDS       T01015                                 
Name
(RefSeq) protein HOMOLOG OF MAMMALIAN LYST-INTERACTING PROTEIN 5
  KO
K12199  vacuolar protein sorting-associated protein VTA1
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    4340850
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4340850
Membrane trafficking [BR:osa04131]
 Endosome - Lysosome transport
  Endosomal sorting complexes required for transport (ESCRT)
   ESCRT associated proteins
    4340850
SSDB
Motif
Pfam: Vta1 Vta1_C
Other DBs
NCBI-GeneID: 4340850
NCBI-ProteinID: XP_015644354
UniProt: Q5Z4L5 A0A0N7KLZ9
LinkDB
Position
6:11712576..11717048
AA seq 488 aa
MGSDAEPAKGLLPYLQRADELQKHEPLVAYYCRLYAMEKGMRIPQKERTKTTNSLLISLM
NQLEKDKKSLTLGSDDHLHVEGFALNVFAKADKQDRAGRADINTAKTFYAASIFFEILNQ
FGELQTDVEQKQKYAIWKAAEIRKALKEGRRPEAGPPGGDKDEAPDSTTTNSHLTDMGRS
QSFGSGQHGNEASSQHVDQDFSRRDSFSAVQPGNNALRHSTEKFNDHVSAQSPYSPPPPQ
SQTPPQSQFSSPAQSSYSSPSYQGTDYPSSDVHKPPHGYSSAPYTSTDYPTNEVHKPPSN
YSSPPYTRTDYPSSDSYNPQSNDKPDIPTYPHTYHQPPYTIEPQHTSQNYYSTETPAAPY
NYSNFQSYPSFQDSSVPSVPTHQSSFYPASDGTSAVSYSPSGSNHPAPTQYHPSADTTTH
QVTPPAIAPPASQYKYDSSYQPEVEKIAEAHKAARFAVGALAFDDVSVAVDHLKRALDLL
TNPSAETH
NT seq 1467 nt   +upstreamnt  +downstreamnt
atggggagcgacgcggagccggccaaggggctgctgccctacctgcagcgcgccgacgag
ctgcagaagcacgagccgctcgtcgcctactactgtcggctctacgcgatggagaagggg
atgagaattccgcagaaggagcgcaccaagaccacaaactccctcctcatctctctcatg
aaccagctggagaaggataagaagtcattgactttggggtctgatgaccatcttcatgta
gaggggtttgcattgaatgtctttgctaaagcagacaaacaggatcgtgctggacgagcg
gacataaacactgcaaaaaccttctatgctgccagcatcttctttgagatcctcaaccaa
tttggtgagcttcagactgatgttgagcagaaacagaaatatgccatctggaaggctgct
gaaataagaaaagctctcaaagaaggacggaggcctgaagctggtcctcctggtggggac
aaagatgaagcacctgacagcaccaccacaaattcccatctaacggatatggggcgcagc
caatcctttggcagtgggcagcatgggaacgaagcatcatctcagcatgtagatcaggat
tttagcaggagggatagcttctctgcggtccaaccaggaaataatgcactccggcacagt
acagagaagttcaatgaccatgtctctgcccagtcaccttattcaccaccacccccacaa
tcccagacgcccccacaatcccagttttcatctcctgcacagtcatcttattcctctccg
tcatatcaaggaacagattacccttcttctgatgttcacaaaccaccccacggttattca
tccgccccatatacaagcacagactaccctaccaatgaggtccacaaaccaccatccaat
tattcctcaccaccgtacacaagaacagactacccttccagtgatagctacaatccccag
agcaatgataaaccagatatccctacttatcctcacacataccaccagccaccctacaca
attgaaccgcagcacacatctcaaaactactactctacagaaaccccagctgctccgtat
aactactctaattttcagtcctatccaagctttcaggacagctcggtaccttctgtccca
actcatcagtcttcgttctatcctgctagtgatggtacaagcgctgtatcatactctcct
tctggatcgaaccatcctgcaccaacacaataccacccgagtgctgatactactacgcat
caagttactccccctgctatcgcaccaccggctagccaatacaagtatgatagcagttac
cagccagaagttgaaaagattgccgaggctcacaaggcagcaagatttgcagttggtgcc
ctcgcatttgacgacgtgtcggtcgctgttgatcacctgaagcgcgcgctggatcttctg
acgaacccttccgccgaaactcattag

DBGET integrated database retrieval system