KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4341069
Entry
4341069           CDS       T01015                                 
Name
(RefSeq) formate dehydrogenase 1, mitochondrial
  KO
K00122  formate dehydrogenase [EC:1.17.1.9]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00630  Glyoxylate and dicarboxylate metabolism
osa01100  Metabolic pathways
osa01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    4341069
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.9  formate dehydrogenase
     4341069
SSDB
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh NAD_binding_2 Shikimate_DH UDPG_MGDP_dh_C
Other DBs
NCBI-GeneID: 4341069
NCBI-ProteinID: XP_015643973
UniProt: Q9SXP2 Q0DC43 B7EBG8
LinkDB
Position
6:16649539..16653247
AA seq 376 aa
MAMWRAAAGHLLGRALGSRAAHTSAGSKKIVGVFYKGGEYADKNPNFVGCVEGALGIREW
LESKGHHYIVTDDKEGLNSELEKHIEDMHVLITTPFHPAYVSAERIKKAKNLELLLTAGI
GSDHIDLPAAAAAGLTVAEVTGSNTVSVAEDELMRILILLRNFLPGYQQVVHGEWNVAGI
AYRAYDLEGKTVGTVGAGRIGRLLLQRLKPFNCNLLYHDRLKIDPELEKEIGAKYEEDLD
AMLPKCDVIVINTPLTEKTRGMFNKERIAKMKKGVIIVNNARGAIMDTQAVADACSSGQV
AGYGGDVWFPQPAPKDHPWRYMPNHAMTPHISGTTIDAQLRYAAGVKDMLDRYFKGEDFP
VQNYIVKEGQLASQYQ
NT seq 1131 nt   +upstreamnt  +downstreamnt
atggcgatgtggagggcggcggcggggcatcttctcggccgcgcgctcggctccagggcc
gcgcacacatcagcaggcagcaagaagatcgtgggtgtgttctacaagggcggcgagtac
gccgacaagaatcccaacttcgtcggctgcgtggagggcgctctcggcatccgcgaatgg
cttgagtccaaggggcatcactacattgtcaccgacgacaaggaggggctaaacagcgag
ctggagaagcacattgaggatatgcatgtcttgatcaccacccctttccacccagcctat
gttagcgcagaaaggatcaagaaggcaaagaacctcgagctgcttctcacagctgggatt
gggtcagatcatattgatctgccagcagctgctgcagcaggtttaactgtggcagaggtt
accggaagtaacactgtgtcggtggcagaagatgagctcatgcgcattttgattttgctc
aggaacttcttgcccgggtatcagcaggttgttcatggtgaatggaatgttgctggcatt
gcctatagggcttatgatcttgaaggaaaaactgtggggactgttggggctggtcgtatt
ggcaggctcttacttcagcgtcttaagccctttaactgcaacctgctgtaccatgacaga
cttaaaattgacccagaacttgagaaagaaattggggccaaatatgaagaggatctcgat
gctatgcttccaaagtgtgatgtcattgtgatcaatacacctcttacagagaaaacaaga
ggtatgtttaataaagaaagaattgcaaagatgaagaaaggtgtaatcattgtgaataat
gctcgaggagcaatcatggatacccaggcggttgcagacgcttgctctagtggtcaagtt
gcaggatatggtggtgatgtctggttcccccaaccagcaccaaaggatcacccatggcga
tacatgcctaatcatgccatgacccctcatatctctgggactacaattgatgcacagctg
agatacgcagcaggagtgaaggacatgctggacaggtacttcaaaggggaagacttcccg
gtgcagaactacatcgtcaaggaaggtcagctcgcgagccagtaccagtaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4341070
Entry
4341070           CDS       T01015                                 
Name
(RefSeq) formate dehydrogenase 2, mitochondrial
  KO
K00122  formate dehydrogenase [EC:1.17.1.9]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00630  Glyoxylate and dicarboxylate metabolism
osa01100  Metabolic pathways
osa01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    4341070
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.9  formate dehydrogenase
     4341070
SSDB
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh NAD_binding_2 Shikimate_DH
Other DBs
NCBI-GeneID: 4341070
NCBI-ProteinID: XP_015642621
UniProt: Q67U69
LinkDB
Position
6:16676478..16683046
AA seq 378 aa
MAMWRAPSAAGQLLGRALASTAAQTSAGSKKVVGVFYKGGEYADKNPNFVGCVDSALGIR
GWLESKGHRYIVTDDKEGINCELEKHIEDAHVLITTPFHPAYITAERIKKAKNLELLLTA
GVGSDHIDLPAAAAAGLTVAEITGSNTVSVAEDQLMRILLLLRNFLPGHHQIVNGEWNVA
GIAHRTYDLEGKTVGTVGAGRIGRLLLQRLKPFNCNLMYHDRVKIDPELEKEIGAKYEED
LDAMLPKCDVVVINMPLTEKTRGMFNKERIAKMKKGVTIVNNARGAIMDTQAVADACASG
HVAGYGGDVWFPQPAPKDHPWRYMPNHAMTPHCSGTTIDGQLRYAAGVKDMLDRYFKGED
FPAQNYIVKAGQLASQYQ
NT seq 1137 nt   +upstreamnt  +downstreamnt
atggcgatgtggagggcaccgtcggcggcggggcagctgctcggccgcgcgcttgcatct
acggctgcgcagacatcagcaggcagcaagaaggtcgtgggtgtgttctacaagggtggc
gagtatgccgacaagaatcccaacttcgtcggctgcgtcgactccgctctcggcattcgc
ggctggcttgaatctaaggggcatcgctacattgtcaccgatgacaaggaggggataaac
tgcgagctggagaagcacatcgaggatgcccacgtcctgatcaccaccccattccaccca
gcctacatcaccgcagagaggatcaagaaggccaagaacctggagcttcttctcacggcc
ggggtcgggtcagaccacatcgatctcccagcagccgcggcagcaggtctaaccgtggcg
gagatcaccggcagcaacaccgtctccgtggctgaagaccagctcatgcgcatcctgctt
cttctcaggaacttcttgcctggtcaccatcagatcgttaatggcgaatggaatgtcgcg
ggcattgcccacagaacctatgatcttgagggcaaaactgtgggcactgttggtgctggt
cgcatcggcaggctcctgcttcagcgtctcaagcccttcaactgcaacctgatgtaccat
gacagggtgaagattgacccggagcttgagaaggagattggggccaagtatgaggaggat
ctcgatgccatgcttccaaagtgtgatgtcgttgtgatcaacatgcctcttacggagaaa
acaagaggtatgtttaacaaagagaggattgcaaagatgaagaaaggtgtgaccattgtg
aacaatgctcgtggagcaatcatggatacccaggcggttgctgacgcttgcgccagtggt
cacgttgcaggatatggtggtgacgtctggttcccccagccagcaccaaaggatcaccca
tggcgatacatgcccaatcatgctatgacccctcactgctctgggactacaattgatgga
cagctgagatacgcggcgggggtaaaggacatgctggacaggtatttcaaaggggaggac
ttcccggcgcagaactacatcgtcaaggcaggccagctcgccagccagtatcagtaa

DBGET integrated database retrieval system