KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4341492
Entry
4341492           CDS       T01015                                 
Name
(RefSeq) 116 kDa U5 small nuclear ribonucleoprotein component
  KO
K12852  116 kDa U5 small nuclear ribonucleoprotein component
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    4341492
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:osa03041]
    4341492
Spliceosome [BR:osa03041]
 Complex B
  U4/U6.U5 tri-snRNP components
   U5 snRNP specific factors
    4341492
 Complex C
   U5 SnRNP specific factors
    4341492
SSDB
Motif
Pfam: GTP_EFTU EFTUD2 EFG_IV EFG_C GTP_EFTU_D2 EFG_III MMR_HSR1 Roc Septin Ras
Other DBs
NCBI-GeneID: 4341492
NCBI-ProteinID: XP_015643866
UniProt: Q69V60 A0A0P0WYL8
LinkDB
Position
6:complement(24206692..24212569)
AA seq 997 aa
MDDSLYDEFGNYIGPELADSDADDSDADASPSPSPSRSPSPSARSPSGSPSRPAALMDVD
GGDDDDDADPSQSAVVLAEDKKYYPTAEEVYGPGVEALVMDEDEQPLEQPIVAPPRVVRF
EVGTRAEATSTYATTDFLLGLAANPALVRNVALVGHLQHGKTVFMDMLVEQTHEVDTFDS
EGERHVRFTDTRVDEQERRVSIKAVPMSLVLEGGNGKSYLCNIMDTPGHVNFSDEMTAAL
RIADGAVLVVDAAEGVMVNTERAIRHATQERLPIVVVINKVDRLITELKLPPNDAYFKLR
HTLEAINDLISSCSTTVGGTQLVDPAAGNVCFASGSAGWSFTLQSFAHLYLKIHGIQFDH
EKFASRLWGDLYYHPDTRTFKKKPPKEGANRSFVEFVLEPLYKIYSQVVGESKGKVEATL
SELGVTLSNAAYKLNVRPLLRLACRSIFGTSTGFTDMLVKHIPSVKDAAPRKIEHIYTGP
QDSTIVDAMKKCDPHAPLMVNVTKLYPKSDCSVFDAFGRVYSGTIQTGQTVRVLGEGYSP
DDEEDMTVKEVTKLWVYQARYRVPISKAPAGSWVLIEGVDASIMKTATICPMKMDEDVYI
FRPLRFNTLPVVKIAAEPLNPSELPKMVEGLRKISKSYPLAVTKVEESGEHTILGTGELY
LDSIMKDLRELYSEVEVKVADPVVTFCETVVDTSSMKCFAETPNKRNKITMVAEPLEKGL
AEDIENGLVSLDSRQKEITDFFRQRYQWDVLAARSIWAFGPEKQGPNILLDDTLSVEVDK
NLLNAVKDSIVQGFQWGAREGPLCDEPIRNVKFKILNANIAPEPLHRGGGQIIPTARRVV
YSAFLMANPRLMEPVYYIEIQTPIDCVSAIYTVLSRRRGHVTADVPKPGTPIYVVKAFLP
VIESFGFETDLRYHTQGQAFCLSVFDHWAIVPGDPLDKNIVLRPLEPAPIQHLAREFMVK
TRRRKGMSEDVSINKFFDEAMMNELAQQAADLHLQMM
NT seq 2994 nt   +upstreamnt  +downstreamnt
atggacgacagcctctacgacgagttcggcaactacatcggcccggagctcgccgactcc
gacgccgatgactccgacgcggacgcctccccgtccccctccccgtcccgctccccttcc
ccctccgcgcgctccccgtcgggctccccctcccgccccgccgctctcatggacgtcgac
ggcggcgacgacgacgacgacgccgacccgtcccagagcgccgtcgtcctcgccgaggac
aagaagtactaccccaccgccgaggaggtgtacgggcccggcgtggaggcgctcgtcatg
gacgaggatgagcagccgctagagcagcccatcgtcgcgcccccacgcgtcgtgaggttc
gaggtcggcacccgcgcggaggccacctccacctacgccaccaccgacttcctcctcggc
ctcgccgccaacccggcgctggtgcgcaacgtcgcgctcgtgggccacctgcagcacggg
aagacggtgttcatggacatgctcgtggagcagacccacgaggtggacaccttcgactcc
gagggcgagcgccatgtgaggttcaccgacacccgggtggatgagcaggagcggcgggtg
tccatcaaggccgtgcccatgtcccttgtgcttgagggagggaatggcaagtcatacctg
tgcaatatcatggacacacctgggcatgtcaatttttccgatgagatgactgccgcgttg
cggatcgctgatggggctgtgcttgttgtcgatgctgccgagggtgttatggtaaataca
gagagggcgattcgtcacgcaacacaagaaagactccccattgttgtcgtgattaacaag
gttgatagattgattacagagctaaagctgccacctaatgatgcatatttcaagctacgg
catacactggaggcgatcaatgatctcatctcgtcttgttctaccacagtaggtggcact
caactggttgatcctgctgctggaaatgtttgttttgcaagtggttctgcaggctggtct
tttaccttgcaatcttttgctcatctttatttaaagatccatgggattcaatttgatcat
gagaaatttgcatcgcgtctatggggagacctatattatcaccctgacactagaaccttc
aaaaagaagcctccaaaggaaggagctaatagatcatttgttgagtttgtccttgaacct
ttgtacaaaatatatagtcaggttgttggggagtcaaagggtaaggttgaagcaactctt
tctgagctgggtgtgacgctgagcaatgcagcttataagcttaatgttaggcctttgctg
agattagcttgtcgctcaattttcgggacttctactggctttactgacatgctagtgaaa
cacataccctctgtcaaggatgctgctccaaggaagatagaacacatatacactggtcca
caagattccactattgtggatgctatgaaaaaatgtgatccacatgcgccccttatggtt
aatgttacaaagttgtatcctaagtctgactgtagtgtctttgatgcctttggacgagtt
tatagtggcacaatacagactgggcaaactgtgcgtgttcttggagaaggctattctcct
gatgatgaagaagatatgactgtgaaagaggttactaagttgtgggtgtatcaggcacgg
taccgtgttccaattagtaaagcccctgctggttcttgggttcttattgaaggtgtagat
gcatcaattatgaaaactgcaactatatgtcctatgaagatggatgaagatgtctacata
tttagacctctacgtttcaatactctacctgtcgtgaaaatagcagctgagcctctaaac
ccaagtgagctccctaagatggtggaaggtcttcgtaaaatcagtaagagttatcctctt
gctgttactaaggtggaagagtctggagaacacactatccttgggactggtgagctttat
ctagattctataatgaaggacctcagagagctttactctgaggtagaagtgaaggttgca
gatccagtcgtgacattttgtgaaacagttgttgatacttcttcgatgaaatgctttgct
gaaacacccaacaagaggaacaaaattaccatggttgctgaaccattggaaaagggcttg
gctgaagatattgagaacggccttgttagcctggactcaaggcaaaaggaaatcactgac
ttctttcgtcaacgctaccagtgggatgtgctagcagcaaggtcaatatgggcttttggg
cctgaaaagcagggtcctaacattctcttagatgacaccctttcagtcgaggtggataaa
aacttgctcaatgcagtcaaagattcaattgttcaagggtttcaatggggtgctagagaa
ggtccgctgtgtgatgaaccaattagaaatgtgaaattcaagatcttaaatgcaaacata
gctcctgaaccgttgcaccgtggtggtggtcagataattccaacagctcgtcgtgtggtt
tactcagcgttcctaatggctaatccacgccttatggagcctgtatattatattgagatc
caaacaccaattgactgtgtctctgccatatatacggtgctatcccgtcgtcgagggcat
gtaacagcggatgtacccaaaccaggaactccaatctatgttgttaaggcatttttacct
gttatagagtcatttggatttgagaccgacctgaggtaccatacacagggacaggccttt
tgcctatcagtgttcgatcactgggctattgttcctggtgaccctttagacaagaatatt
gtcctccggcctctggaaccagcaccaatacagcatcttgctcgtgagtttatggtgaag
actaggcgaaggaagggcatgagtgaggatgtgagcatcaacaagttctttgatgaggcc
atgatgaacgagctggcgcagcaggctgctgatctccatcttcaaatgatgtag

DBGET integrated database retrieval system