KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4341494
Entry
4341494           CDS       T01015                                 
Name
(RefSeq) vacuolar protein sorting-associated protein 32 homolog 2
  KO
K12194  charged multivesicular body protein 4A/B
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03250  Viral life cycle - HIV-1
osa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09125 Information processing in viruses
   03250 Viral life cycle - HIV-1
    4341494
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    4341494
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4341494
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4341494
Membrane trafficking [BR:osa04131]
 Endosome - Lysosome transport
  Endosomal sorting complexes required for transport (ESCRT)
   ESCRT-III complex
    4341494
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   4341494
  Exosomal proteins of other body fluids (saliva and urine)
   4341494
  Exosomal proteins of colorectal cancer cells
   4341494
SSDB
Motif
Pfam: Snf7 TraF_2 SRP_TPR_like Flu_C_NS2 EMP24_GP25L
Other DBs
NCBI-GeneID: 4341494
NCBI-ProteinID: XP_015644535
UniProt: A3BDG1 Q69V59
LinkDB
Position
6:24218366..24223254
AA seq 220 aa
MSGVFGKVFGKSKAQSQATALASIDKLSETLEMLEKKENLLVKKANLEVEKAKTFTKAKN
KRAAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGASAMKAMHK
ATNIDDVDKTMDEINDNMENMRQIQDLLSAPIGAAADFDEDELEAELADLEGEELEAELL
APTTTAPTAPVRVQQPTRPSAQSSKTEDDELAALQAEMAM
NT seq 663 nt   +upstreamnt  +downstreamnt
atgtcgggggtgttcggcaaggtgttcgggaagtccaaggcgcagagccaggccaccgcg
ctggcctccatcgacaagctcagcgagactcttgaaatgctggaaaagaaagaaaatttg
ctagtgaagaaagcgaatcttgaggttgagaaggccaagaccttcactaaagcgaagaat
aaaagagctgcaatacaatgcttaaagaggaagagattatatgagcaacagattgagcag
cttggtaatttccaattaaggatacatgatcagatgataatgctggaaggtgcaaaggct
acaacagagactgttgatgcattgagaactggagcatcggcgatgaaagcaatgcacaaa
gcgacaaatattgacgacgttgacaagacaatggatgaaattaatgacaatatggagaat
atgaggcagatccaggatctactatctgctcctattggagctgcagctgattttgatgaa
gatgagctggaagctgaattagcagatctggagggggaggaattggaggcagagcttcta
gcacctacaacgactgcccctactgctccagtgcgtgtacagcaaccaactcggccttct
gcccagagcagcaaaactgaagatgacgagttggcagctttgcaggcagagatggctatg
taa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4343270
Entry
4343270           CDS       T01015                                 
Name
(RefSeq) vacuolar protein sorting-associated protein 32 homolog 1
  KO
K12194  charged multivesicular body protein 4A/B
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03250  Viral life cycle - HIV-1
osa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09125 Information processing in viruses
   03250 Viral life cycle - HIV-1
    4343270
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    4343270
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4343270
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4343270
Membrane trafficking [BR:osa04131]
 Endosome - Lysosome transport
  Endosomal sorting complexes required for transport (ESCRT)
   ESCRT-III complex
    4343270
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   4343270
  Exosomal proteins of other body fluids (saliva and urine)
   4343270
  Exosomal proteins of colorectal cancer cells
   4343270
SSDB
Motif
Pfam: Snf7 HSCB_C tRNA-synt_1c
Other DBs
NCBI-GeneID: 4343270
NCBI-ProteinID: XP_015645576
UniProt: A0A0P0X602 Q7XHQ7
LinkDB
Position
7:18250917..18253362
AA seq 97 aa
MFAWLLRGCRDECSASDQLKQARDVFVAKEAVLQKKISQEMERAKEFTKSGNKQAAMQCL
KRKKYYESQMNQVGSVQLRINTKEKMIADHSGNKEDK
NT seq 294 nt   +upstreamnt  +downstreamnt
atgttcgcctggctcctccgcggctgccgcgacgagtgctccgcctccgaccagctcaag
caggcccgtgatgtcttcgtggcaaaagaggcagttctgcaaaagaagatctctcaggag
atggaacgtgccaaggagttcacaaaatcaggaaataagcaagcagcaatgcagtgcttg
aagaggaagaaatactatgaaagccaaatgaatcaggttggaagtgtccagttgcgcatt
aataccaaggagaagatgattgctgatcatagcgggaataaagaagacaagtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4346566
Entry
4346566           CDS       T01015                                 
Name
(RefSeq) vacuolar protein sorting-associated protein 32 homolog 2
  KO
K12194  charged multivesicular body protein 4A/B
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03250  Viral life cycle - HIV-1
osa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09125 Information processing in viruses
   03250 Viral life cycle - HIV-1
    4346566
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    4346566
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4346566
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4346566
Membrane trafficking [BR:osa04131]
 Endosome - Lysosome transport
  Endosomal sorting complexes required for transport (ESCRT)
   ESCRT-III complex
    4346566
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   4346566
  Exosomal proteins of other body fluids (saliva and urine)
   4346566
  Exosomal proteins of colorectal cancer cells
   4346566
SSDB
Motif
Pfam: Snf7 DUF6437 TraF_2
Other DBs
NCBI-GeneID: 4346566
NCBI-ProteinID: XP_015651277
UniProt: Q0J328 B7EB98
LinkDB
Position
9:5103028..5106854
AA seq 220 aa
MFNRLFGKPKEQANASALATLDKLNETLDMLEKKEKVLEKKAAAELERAKEFSKAKNKRA
AIQSLKRKKLYEQQIEQLGNFQLRIHDQMIMLEAAKATTETVDALRTGAAAMKAMQKATN
IDDVDKTMDEINEQTENMKQIQDALSAPLGASADFDEDELEAELEELEGAELESQLLEPV
AAPPVHPVQVPGTRIPTRPAPQKASAEEDELAALQAEMAL
NT seq 663 nt   +upstreamnt  +downstreamnt
atgttcaacaggctctttggtaagcccaaggagcaggccaatgctagtgcgttggccacg
cttgataagttaaatgagacccttgacatgctggagaagaaggagaaagtcttagagaaa
aaggcagccgcagaactggagagggctaaggagttctcaaaagcaaagaataaaagagcg
gctatccaatccttgaagagaaaaaagctttatgaacaacaaattgagcagctagggaac
ttccagttgagaattcatgatcagatgatcatgttagaagctgcaaaagctacgacagaa
accgttgatgctttgaggactggagctgcagctatgaaagcaatgcaaaaggcgacaaat
attgatgacgttgataagactatggatgaaattaatgaacagactgaaaacatgaaacaa
atacaagatgctttgtcagcccctcttggagcatctgctgattttgatgaggacgaacta
gaggcagaactggaagaactggagggagcagaattggaatctcagcttctcgagcctgtt
gcagctccacctgtgcatccagtgcaggtcccaggcaccaggataccaactcgccctgct
ccacagaaagcatcagctgaggaggatgagcttgcagccttgcaagctgaaatggcattg
tga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4349637
Entry
4349637           CDS       T01015                                 
Name
(RefSeq) vacuolar protein sorting-associated protein 32 homolog 2
  KO
K12194  charged multivesicular body protein 4A/B
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03250  Viral life cycle - HIV-1
osa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09125 Information processing in viruses
   03250 Viral life cycle - HIV-1
    4349637
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    4349637
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4349637
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4349637
Membrane trafficking [BR:osa04131]
 Endosome - Lysosome transport
  Endosomal sorting complexes required for transport (ESCRT)
   ESCRT-III complex
    4349637
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   4349637
  Exosomal proteins of other body fluids (saliva and urine)
   4349637
  Exosomal proteins of colorectal cancer cells
   4349637
SSDB
Motif
Pfam: Snf7 HGD-D
Other DBs
NCBI-GeneID: 4349637
NCBI-ProteinID: XP_015617670
UniProt: B9G948 Q2RB64
LinkDB
Position
11:complement(1078089..1082469)
AA seq 216 aa
MLKKLLSKPKSKKKEAASSALPTLDRLHETLEMLEKKECFLQKKASAEVEKAKDYTKAKN
KSAAIQCLKKKKLYETQIEQLANFQLRVHDQIIMLESAKATTDTVDALRSGSSAVKAIHQ
SVSIDDIENAIEEANEHTENMRQIQEALATPIGASADFDEDELEAELEDLEEEELDHELP
EPPQSTRMEPSARVTTSSQPANDLAELTKLQAEMAL
NT seq 651 nt   +upstreamnt  +downstreamnt
atgctgaagaaactgctatcaaagcctaagagcaagaagaaggaggctgcctcctctgcg
ctccccactttggatcgtctccatgagactctagaaatgctggagaagaaagagtgcttt
cttcagaagaaggcttctgcagaagttgaaaaggctaaggattatacaaaagctaagaac
aaaagcgctgcaattcagtgtctaaagaaaaagaagctgtatgaaacacaaattgagcag
ctagcaaatttccaattgcgagttcatgatcagataataatgcttgagagcgcaaaggca
accacagataccgttgatgctttgcgctctggatcatctgctgtcaaagctattcatcag
tcagtgagtattgatgacattgaaaatgccattgaagaggcaaatgaacacacagaaaat
atgaggcagatacaggaggcacttgcaacaccaattggcgcttctgctgatttcgacgag
gatgaactagaagcagagctggaagatctggaggaggaagagctcgaccatgagctgcct
gaaccacctcagagtacacgcatggaaccatcagcgagagttacaacttcatctcaacca
gccaatgatttggctgaactgaccaaacttcaagcagagatggcgctttaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4351360
Entry
4351360           CDS       T01015                                 
Name
(RefSeq) vacuolar protein sorting-associated protein 32 homolog 2
  KO
K12194  charged multivesicular body protein 4A/B
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03250  Viral life cycle - HIV-1
osa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09125 Information processing in viruses
   03250 Viral life cycle - HIV-1
    4351360
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    4351360
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4351360
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4351360
Membrane trafficking [BR:osa04131]
 Endosome - Lysosome transport
  Endosomal sorting complexes required for transport (ESCRT)
   ESCRT-III complex
    4351360
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   4351360
  Exosomal proteins of other body fluids (saliva and urine)
   4351360
  Exosomal proteins of colorectal cancer cells
   4351360
SSDB
Motif
Pfam: Snf7 HGD-D
Other DBs
NCBI-GeneID: 4351360
NCBI-ProteinID: XP_015620601
UniProt: Q2QYF7 A0A8J8YG28
LinkDB
Position
12:complement(1012214..1016837)
AA seq 216 aa
MLKKLLSKPKSKKKKEAASSALPTLDRLHETLEMLEKKECFLQKKASAEVERAKDYTKAK
NKSAAIQCLKKKKLYETQIEQLANFQLRVHDQIIMLESAKATTDTVDALRSGSSAVKAIH
QSVSIDDIENAIEEANEHTENMRQIQEALATPIGASADFDEDELEAELEDLEEEELENDL
PEPPQRTSMEPSARVTTTQPANDLAELTKLQAEMAL
NT seq 651 nt   +upstreamnt  +downstreamnt
atgctgaagaaactgctatcaaagcccaagagcaagaagaagaaggaggctgcctcctct
gccctccccactttggataggcttcatgagactctagaaatgctggagaagaaagagtgt
ttccttcagaaaaaggcttctgcagaagtcgaaagagctaaggactatacaaaagctaag
aacaaaagcgctgcaattcaatgtctaaagaaaaagaagttgtatgaaacacagattgag
cagctagcaaacttccaattacgggttcatgatcagataataatgcttgagagtgcaaag
gcaaccacagatactgttgatgctttgcgctctggatcatctgctgtcaaagctattcac
cagtcagtgagtatcgatgacattgaaaatgccattgaagaggcaaatgaacacacagag
aatatgaggcagatacaggaggcccttgcaacaccaattggcgcttctgctgattttgac
gaggatgagctagaagcagagctggaagatctagaggaggaagagctcgagaatgatctg
cctgaaccacctcagaggacaagtatggaaccttcagcgagagttacgactactcaacca
gccaatgatttggctgaactgaccaaacttcaagcagagatggcgctttga

DBGET integrated database retrieval system