KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4341640
Entry
4341640           CDS       T01015                                 
Name
(RefSeq) formamidopyrimidine-DNA glycosylase
  KO
K10563  formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    4341640
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:osa03400]
    4341640
Enzymes [BR:osa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     4341640
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     4341640
DNA repair and recombination proteins [BR:osa03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     4341640
SSDB
Motif
Pfam: Fapy_DNA_glyco H2TH NFACT_N
Other DBs
NCBI-GeneID: 4341640
NCBI-ProteinID: XP_015641389
UniProt: Q67WP0 Q0DAN0
LinkDB
Position
6:complement(26229859..26232880)
AA seq 400 aa
MPELPEVEAARRALEAHCVGRRIARCAVADDPKVVVAAAGGRVAFERAMVGRTIVAARRR
GKNLWLRLDAPPFPSFQFGMAGAIYIKGVPVTKYKRSVVSSTDEWPSKYSKFFVQLDDGL
EFSFTDKRRFARVRLFEDPETVPPISELGPDALFEPMSSDSFADSLSRKKIGIKALLLDQ
SFISGIGNWIADEVLYQSRTHPLQIASSLSRESCEALHQSIQEVVKYAVEVDADCDCFPV
EWLFHHRWGKKPGKVNGQKIEFITAGGRTTAYVPQLQKLTGMQSSKVVIANPEQVAENDD
AKEIDTDPEDADNLNTKKRGATSRVARGKQKRDAIGALSRKTRKNGGGKEKPGSDYSEDD
GETAEPNKVSTSSKGEKADPVRRSSRTASKPRQVNKLKER
NT seq 1203 nt   +upstreamnt  +downstreamnt
atgccggagctgccggaggtggaggcggcgaggagggcgctggaggcgcactgcgtgggg
aggaggatcgcgcgctgcgcggtggcggatgaccccaaggtggtggtcgccgccgccggg
gggcgcgtggcgttcgagcgcgccatggtcggccggaccatcgtcgccgcgcggcggagg
ggcaagaacctctggctccgcctcgacgcccctccattcccctccttccagttcgggatg
gcaggtgcgatctacattaagggagttcctgtgaccaagtacaagagatcagttgtcagt
tctacagacgagtggccctccaagtactccaaattttttgttcaacttgatgatggctta
gagttttccttcactgataagaggcggtttgcaagagttcggttgtttgaagatcccgaa
actgtacccccgatttctgagttaggaccagatgctctctttgagccgatgtcttctgac
agttttgcggactcgctgagcagaaagaagattggaataaaagctcttctactcgatcag
agcttcatatcaggaattggtaattggattgcagatgaggtgctttaccagtcgagaacc
catccattacagattgcttcaagtctatccagggagagttgtgaagcactacaccaaagc
atccaagaggttgtgaaatatgctgttgaagttgatgctgattgtgactgctttcctgtg
gaatggttattccatcaccgatggggcaagaagcctggtaaagtcaatggacagaaaatt
gagttcataacagctggtggcaggactacagcatacgtgccacaactgcagaagctgact
ggaatgcaatctagcaaagtagtcattgctaacccagaacaagtggcagagaacgatgat
gcgaaggaaatagacacagatccagaagatgctgataatttgaatacaaagaagcgagga
gcaacttctagggttgccaggggaaagcaaaagagagatgccataggtgccctttccaga
aagacaaggaaaaatggtggtggcaaggagaaaccaggtagtgactatagtgaagatgat
ggtgagactgctgaaccaaacaaagttagcaccagtagcaagggcgagaaggcagatccg
gtgagaagatcatcaaggaccgcatcgaaaccccgccaggtaaataaattaaaagaaaga
tag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4345225
Entry
4345225           CDS       T01015                                 
Name
(RefSeq) formamidopyrimidine-DNA glycosylase isoform X1
  KO
K10563  formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    4345225
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:osa03400]
    4345225
Enzymes [BR:osa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     4345225
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     4345225
DNA repair and recombination proteins [BR:osa03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     4345225
SSDB
Motif
Pfam: H2TH Fapy_DNA_glyco NFACT_N TFIIF_alpha PsbP_2 Cwf_Cwc_15
Other DBs
NCBI-GeneID: 4345225
NCBI-ProteinID: XP_015651002
UniProt: B9G081
LinkDB
Position
8:12710733..12719263
AA seq 415 aa
MPELPEVEVARRALEEHCVGKRIVRCSAADDTKVIDGVAPPRLEAALVGRTISAARRKGK
NLWLALDSPPFPSFQFGMAGAIYIKGVELSKYKRSAVSPTEEWPLKYSKLLVVMDDGLEF
SFTDKRRFAKIRFLDNPEAVPPISELGPDALFEPLHLDDFVESLSRKKAPIKALLLDQSF
ISGIGNWIADEVLYQARIHPMQTASMISKEKCKALHQCIIEVIEKSLEVGCNSSQYPENW
IFHSREKKPGKAFVEGKKIDFITVGGRTSAYVPELQKLDGIDATASRAKISKEQSKSNKA
AREVDDDEEEAKPAKRGRKQLVKATHEIQEDEEDTKESKRGRKQPAKTSKGSWKKAHHSS
EGSGDDDSDDEAVDKVVAEQGKRRDPKQPAEAKSSSDKGGSAAPAKRPQRKKRQL
NT seq 1248 nt   +upstreamnt  +downstreamnt
atgccggagctgccggaggtggaggtggcgcgacgggcgctggaggagcactgcgtcggg
aagaggatcgtgcggtgctcggctgcagatgacaccaaggtcatcgacggcgtcgccccg
ccgcggctggaggcagcgcttgtcgggaggaccatctccgctgctcgccgcaagggcaag
aatctgtggcttgcgcttgattctccgcccttcccttccttccagttcggaatggctgga
gctatttacatcaagggtgtggaactgagcaaatacaaaaggtctgcagtgagcccgact
gaggaatggcctttgaagtattccaagctgcttgttgtaatggatgatggtttggagttt
tccttcactgataagaggcgttttgcaaaaattcgctttcttgacaatccagaagctgtc
ccaccaatttctgagcttggaccagatgccttatttgaacctcttcatcttgatgatttt
gtagagtcactaagtaggaaaaaagctccaataaaagcccttttgcttgatcagagcttt
atatcaggaattggcaattggattgcagatgaagtgctttatcaggcaaggattcatcca
atgcaaacagcatcgatgatttctaaggagaaatgcaaggcactccatcagtgcattata
gaggtgattgaaaagtccttagaagttggttgcaacagcagtcagtatccagaaaactgg
atatttcactccagggagaagaaacccggcaaggcctttgtggaggggaagaaaattgac
ttcattacagttggtggcaggacttcagcatatgtgccagagttgcagaagctggacggg
attgatgcaacagcaagcagagcgaaaataagcaaagaacagagcaaatcaaataaagct
gctcgtgaagtggacgatgatgaggaagaggctaaacctgccaagaggggaaggaagcaa
ttagtgaaggcaacccatgagatccaagaggatgaggaagatacaaaagaatcaaagaga
ggaaggaagcaaccagcaaagacatcgaagggctcgtggaagaaagctcatcattcttct
gagggtagtggtgacgacgacagtgatgatgaagcagttgataaggtggtcgcggaacaa
gggaagaggagggatccaaagcaaccagcagaggcgaaaagctcgtcagacaaaggagga
agtgctgccccagcaaagaggccacagaggaagaagcggcaattatag

DBGET integrated database retrieval system