KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4341663
Entry
4341663           CDS       T01015                                 
Name
(RefSeq) homogentisate geranylgeranyltransferase, chloroplastic
  KO
K09833  homogentisate phytyltransferase / homogentisate geranylgeranyltransferase [EC:2.5.1.115 2.5.1.116]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00130  Ubiquinone and other terpenoid-quinone biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01240  Biosynthesis of cofactors
Module
osa_M00112  Tocopherol/tocotorienol biosynthesis, homogentisate + phytyl/geranylgeranyl-PP => tocopherol/tocotorienol
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    4341663
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:osa01006]
    4341663
Enzymes [BR:osa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.115  homogentisate phytyltransferase
     4341663
    2.5.1.116  homogentisate geranylgeranyltransferase
     4341663
Prenyltransferases [BR:osa01006]
 Compound prenylation
  HGA prenyltransferase
   4341663
SSDB
Motif
Pfam: UbiA
Other DBs
NCBI-GeneID: 4341663
NCBI-ProteinID: XP_015641999
UniProt: Q0DAK7
LinkDB
Position
6:complement(26435189..26439393)
AA seq 404 aa
MQASSAAAAAACSAIKPAAHQHTVQVQEDKRGSEFRARFGTRKLSWGGKLSVENSALHQC
QSLTRSIRRQKRQHSPVLQVRCYAIAGDQHESIATEFEEICKEVPQKLGAFYRFCRPHTI
FGTIIGITSVSLLPMRSLDDFTMKALWGFLEALSSSLCMNIYVVGLNQLYDIQIDKVNKP
SLPLASGEFSVATGAVLVLTSLIMSIAIGIRSKSAPLLCALFISFFLGSAYSVDAPLLRW
KRNAFLAASCILFVRAVLVQLAFFAHMQQHVLKRPLAPTKSVVFATLFMCCFSSVIALFK
DIPDIDGDRHFGVESLSVRLGPERVYWLCINILLTAYGAAILAGASSTNLCQMIITVFGH
GLLAFALWQRAQHCDVENKAWITSFYMFIWKLFYAEYFLIPFVQ
NT seq 1215 nt   +upstreamnt  +downstreamnt
atgcaagcctcatcggcggcggcggcggcggcgtgctcggctatcaagccggcggcgcat
cagcacaccgtgcaagtccaggaagataagaggggatcggaattcagggctcggtttgga
acgaggaaactgtcctggggaggtaaattgtcggtggaaaattctgctctacaccagtgt
caaagtctcacaagaagcataaggaggcaaaaaagacaacattctccagtcctccaagtg
agatgctatgccattgctggtgatcagcacgaatccatcgccactgagtttgaagaaatt
tgcaaagaagttccccagaaactgggagctttttatcggttttgccgaccccacacaatt
tttggcactataataggaatcacttcagtttctctcctgccaatgaggagcctagatgat
tttactatgaaagcattatggggatttcttgaggctttatcctcttctttatgtatgaat
atctatgttgtaggcctgaatcaactatatgacatccagattgataaggtcaataagccc
agccttccgttggcgtcaggagaattttcagtggcaactggagcagtgttagtactcacg
tccttgatcatgagcattgccattggaatcagatccaaatcagctcctttgttatgtgct
ttgtttatcagtttctttcttggaagtgcatactctgttgatgctccgttactccggtgg
aaaaggaacgcgtttctcgctgcatcttgtatactatttgtaagagctgtcttagttcag
ctagctttctttgcacatatgcagcaacatgttctgaagaggcccttggcaccaacaaag
tcggtggttttcgcaacattattcatgtgttgcttttcttcagttatagctttattcaag
gatattccagatattgatggtgacagacattttggcgtcgaatccctgagcgtacgtttg
ggtccagaaagagtgtattggctctgcataaacatactattaacagcatatggggctgcc
attttggctggagcatcatctacaaatctatgtcaaatgattatcaccgttttcggccat
ggcctgcttgcctttgcactttggcagagagcacagcactgtgacgttgaaaacaaggcg
tggatcacatcattttacatgttcatttggaagttgttctacgctgagtatttccttata
ccatttgtgcagtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4341727
Entry
4341727           CDS       T01015                                 
Name
(RefSeq) probable homogentisate phytyltransferase 1, chloroplastic
  KO
K09833  homogentisate phytyltransferase / homogentisate geranylgeranyltransferase [EC:2.5.1.115 2.5.1.116]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00130  Ubiquinone and other terpenoid-quinone biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01240  Biosynthesis of cofactors
Module
osa_M00112  Tocopherol/tocotorienol biosynthesis, homogentisate + phytyl/geranylgeranyl-PP => tocopherol/tocotorienol
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    4341727
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:osa01006]
    4341727
Enzymes [BR:osa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.115  homogentisate phytyltransferase
     4341727
    2.5.1.116  homogentisate geranylgeranyltransferase
     4341727
Prenyltransferases [BR:osa01006]
 Compound prenylation
  HGA prenyltransferase
   4341727
SSDB
Motif
Pfam: UbiA
Other DBs
NCBI-GeneID: 4341727
NCBI-ProteinID: XP_015644510
UniProt: B7FA90
LinkDB
Position
6:27087460..27093035
AA seq 404 aa
MDSLRLRPSLLAARAPGAASLPPLRRDHFLPPLCSIHRNGKRPVSLSSQRTQGPSFDQCQ
KFFGWKSSHHRIPHRPTSSSADASGQPLQSSAEAHDSSSIWKPISSSLDAFYRFSRPHTV
IGTALSIVSVSLLAVENLSDVSPLFLTGLLEAVVAALFMNIYIVGLNQLFDIEIDKVNKP
TLPLASGEYSPATGVALVSAFAAMSFGLGWAVGSQPLFLALFISFILGTAYSINLPFLRW
KRSAVVAALCILAVRAVIVQLAFFLHIQTFVFRRPAVFTRPLIFATAFMTFFSVVIALFK
DIPDIEGDRIFGIKSFSVRLGQKKVFWICVGLLEMAYCVAILMGATSACLWSKYATVVGH
AILAAILWNRSRSIDLTSKTAITSFYMFIWKLFYAEYLLIPLVR
NT seq 1215 nt   +upstreamnt  +downstreamnt
atggattcgctgcgcctccggccgtcgctcctcgccgcgcgggcccccggcgcggcctcg
ctgccgcctctccggcgagatcactttctaccacctttatgttctatccatagaaatggt
aaacggccagtttctttgtccagccaaaggacccaaggtccttccttcgatcaatgtcag
aaattctttggttggaaatcctcccaccacaggataccacatcgaccaacatctagttcc
gctgacgcttcgggacaacctctacaatcttcagctgaagcacatgattcatcaagtata
tggaagccaatatcatcttctctggatgcattttacaggttttctcggccacatactgtc
ataggaacagcacttagcatagtctcagtttcgctgctagctgttgagaatttgtccgat
gtgtctcccttgttcctcactggtttgctggaggcagtggtagcagctcttttcatgaac
atctatatcgttggattgaatcagttgttcgacattgagatagataaggttaacaagcca
actcttccattagcatctggggaatattctcctgcaactggagttgcacttgtatcagcc
ttcgctgctatgagctttggccttggatgggctgttggatcacagcctctgttcctggct
cttttcattagctttattcttggaacagcatattcgattaatctgccattcctgagatgg
aagagatctgctgttgttgcagcactttgcatattagcagtccgtgcagtgattgttcag
ctggcattttttctccacattcagacattcgtattcagaagaccagcagtctttaccagg
ccattgatttttgcaactgcattcatgacctttttctccgttgtaatagcattgttcaag
gatatacctgatattgaaggagaccgtatttttggtatcaaatctttcagtgttcgatta
ggtcaaaagaaggttttctggatttgtgttggtctgctcgagatggcttattgtgttgca
atattgatgggagctacttctgcctgtttgtggagcaaatacgcaactgtggtgggacat
gcaatccttgcggcaatcctatggaaccgctcacggtcgattgatctgacaagcaaaact
gcaatcacttctttctacatgtttatctggaagctgttctacgcggaataccttctcatt
cctcttgtaaggtga

DBGET integrated database retrieval system