KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4341824
Entry
4341824           CDS       T01015                                 
Name
(RefSeq) probable alpha-glucosidase Os06g0675700 isoform X2
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00052  Galactose metabolism
osa00500  Starch and sucrose metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    4341824
   00500 Starch and sucrose metabolism
    4341824
Enzymes [BR:osa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     4341824
SSDB
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2
Other DBs
NCBI-GeneID: 4341824
NCBI-ProteinID: XP_015643120
UniProt: Q653V7
LinkDB
Position
6:complement(28045477..28058206)
AA seq 885 aa
MMGSPPAPPARRLGALAVFLLALFLAAPWGVDCGYNVASVAGSKNRLRARLELAGGGGGA
APELGPDVRRLSLTASLETDSRLHVRITDADHPRWEVPQDVIPRPSPDSFLAATRPGGGR
VLSTATSDLTFAIHTSPFRFTVTRRSTGDVLFDTTPNLVFKDRYLELTSSLPPPGRASLY
GLGEQTKRTFRLQRNDTFTLWNSDIAAGNVDLNLYGSHPFYMDVRSGGGGGGGAAHGVLL
LNSNGMDVIYGGSYVTYKVIGGVLDFYFFAGPSPLAVVDQYTQLIGRPAPMPYWSFGFHQ
CRYGYKNVADLEGVVAGYAKARIPLEVMWTDIDYMDAYKDFTLDPVNFPADRMRPFVDRL
HRNGQKFVVIIDPGINVNTTYGTFVRGMKQDIFLKWNGSNYLGVVWPGNVYFPDFLNPRA
AEFWAREIAAFRRTLPVDGLWVDMNEISNFVDPPPLNAIDDPPYRINNSGVRRPINNKTV
PASAVHYGGVAEYDAHNLFGFLEARATHDALLRDTGRRPFVLSRSTFVGSGRYTAHWTGD
NAATWEDLHYSINTMLSFGLFGIPMIGADICGFGGNTTEELCSRWIQLGAFYPFSRDHSA
IGTVRRELYLWESVARSARKALGLRYRLLPYLYTLMYEAHTTGAPIARPLFFSYPGDVET
YGIDRQFLLGRGVLVSPVLEPGATTVTAYFPAGRWFSLYDFSLAVATKTGKRVTLPAPAD
TVNVHVAGGNILTLQQPALTSSRVRQSVVHLLVALADDGTATGDLFLDDGESPEMAGPRS
RWSQIKFSGATESGGGVVRVRSHVVHDSYAPSRTMAIGKVVLMGLRSAAPPKGFAVYANG
VQVNASTAVGGAAGSPEKGALGVAHVSGLTLVVGQEFDLKVVMTY
NT seq 2658 nt   +upstreamnt  +downstreamnt
atgatgggctcgccgccggcgccgccggcgcgtcgtcttggcgctctcgccgtcttcttg
ctcgctctcttcctcgccgcgccgtggggcgtcgactgcgggtacaacgtcgcgtcggtg
gccgggtcgaagaaccggctgagggcgcggctggagctcgccggcggcggcggcggcgcg
gcgccggagctcggccccgacgtgcggcggctcagcctgacagcgagcctggagacggac
agccggctacacgtccgcatcaccgacgccgaccaccctcgatgggaggtgccccaggac
gtcatcccgcgcccctcgccggactccttcctcgccgccacacgcccaggcggcggccgc
gtcctctccacggcgacctccgacctcaccttcgccatccacacctccccgttccgcttc
accgtcacccgccgctccaccggtgacgtcctcttcgacaccaccccaaacctcgtcttc
aaggatcgctacctcgagctcacctcctcgctgccgccgcccggccgcgcgtcgctgtac
ggcctcggcgagcagaccaagcgcacgttccggctccagcggaatgacaccttcacgctc
tggaactccgacatcgccgccggcaacgtcgacctcaacctgtacggctcccaccccttc
tacatggacgtgcgctccggcggcggcggcggcggcggcgcggcgcacggcgtgctcctc
cttaacagcaacggcatggacgtcatctatggcggatcctacgtcacctacaaggtgatc
ggcggcgtgctggatttctacttcttcgccggcccgtcccctctcgccgtcgtcgaccag
tacacccagctcatcggccgacctgcccccatgccgtactggtcattcgggttccaccag
tgcaggtacgggtacaagaacgtggctgatcttgagggcgtcgtcgccggctacgccaag
gcgaggatcccactggaggtgatgtggacggacatcgattacatggacgcctacaaggac
ttcacgcttgatccggtgaacttcccggccgaccggatgcggccgttcgtcgaccgcctc
caccgcaacggccagaagttcgtcgtcatcattgacccagggatcaacgtgaacacgacg
tacgggacgttcgtccggggaatgaagcaggacatcttcttgaagtggaacgggagcaac
tacctcggcgtggtgtggccggggaacgtctacttcccggacttcctcaacccgcgcgcc
gccgagttctgggcgcgcgagatcgccgcgttccggcggaccctccccgtcgacgggctg
tgggtcgacatgaacgagatctccaacttcgtcgacccgccgccgctcaacgcgatcgac
gacccgccgtaccgcatcaacaactccggcgtgcgccgccccatcaacaacaagacggtg
ccggcctccgccgtgcactacggcggcgtggccgagtacgacgcgcacaacctcttcggc
ttcctcgaggcgcgggccacgcacgacgcgctgctccgtgacaccggccgccggccgttc
gtgctcagccgctccacgttcgtcggctccggcaggtacaccgctcactggaccggcgac
aacgccgcgacgtgggaggacctccactactccatcaacaccatgctcagcttcggcctc
ttcggcatccccatgatcggcgccgacatctgcggcttcggcggcaacaccaccgaggag
ctctgcagccgctggattcagcttggcgcgttctacccgttctcgagggatcactcggcg
atcggcaccgtccggcgagagctgtacctgtgggagtcggtggcgaggtcggcgaggaag
gcgctcggcctgcgctaccggctgctcccctacttgtacacgctcatgtacgaggcgcac
accaccggcgcgcccatcgcgcggccgctcttcttctcctaccccggcgacgtcgagacg
tacggcatcgacaggcagttcctgctcgggcgcggcgtgctcgtgtcgccggtgctcgag
ccgggcgcgaccaccgtcaccgcctacttcccggccggacggtggttcagcctctacgac
ttctccctcgccgtcgccacgaagaccggcaagcgcgtgacgctgcccgcgccggcggac
acggtgaacgtgcacgtcgccggcgggaacatcctgacgctgcagcagcccgcgctgacg
tcgtcgcgcgtgcgccagagcgtggtccacctcctggtcgcgctcgccgacgacggcacg
gccaccggggatctcttcctggacgacggcgagtcgccggagatggccgggccacggagc
aggtggagccagatcaaattcagcggcgcgaccgagagcggcggcggcgtggtcagagtg
aggtcgcatgtggtgcacgactcgtacgcgccgagccggacgatggccatcggcaaggtg
gtgctcatggggctccggtcggcggcgccgcccaaggggttcgccgtttatgccaacggc
gtccaggtgaacgcgagcacggcggtcggcggcgccgccgggagcccggagaagggagcg
ctgggcgtcgcgcacgtcagcgggctgacgctggtcgtcgggcaggagttcgatctcaag
gtcgtgatgacctattaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4341833
Entry
4341833           CDS       T01015                                 
Name
(RefSeq) probable alpha-glucosidase Os06g0675700
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00052  Galactose metabolism
osa00500  Starch and sucrose metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    4341833
   00500 Starch and sucrose metabolism
    4341833
Enzymes [BR:osa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     4341833
SSDB
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2
Other DBs
NCBI-GeneID: 4341833
NCBI-ProteinID: XP_015640953
UniProt: A0A0P0X053 Q653V4
LinkDB
Position
6:28100735..28106040
AA seq 886 aa
MATRARPPLVLLLCLCLASCLSSAIGGVSAAGNGYRTTAFLVDEEGRRLRAELAAVAGAG
GGSTAAYGDDVQRLDVYASLETDSRLHVRIADADGPRWEVPQDVIPRPSPEFFLQTSRPG
RPVLSTATSDLTFAIHASSPFRFAVSRRSTGDVLFDTSPNLVFKDRYLELTSSLPPPGRA
SLYGLGEQTKRTFRLQRNDTFTLWNSDIAAGNVDLNLYGSHPFYMDVRSGGGGAAHGVLL
LNSNGMDVIYGGSYVTYKVIGGVLDFYFFAGPSPLAVVDQYTQLIGRPAPMPYWSFGFHQ
CRWGYKNVSDLEGVVAGYAKARIPLDVMWTDIDYMDAFKDFTLDPANFPADLLRPFVDRL
HRNGQKYVVIIDPGISVNATYGTFIRAIKEDIFLKWNGSNYLGVVWPGNVSFPDFLNPRA
AEFWAREIAAFRRTLPVDGLWIDMNEISNFVDPPPLNALDDPPYRIDNSGVRRPINNKTV
PASAVHYGGVAEYDAHNLFGFLEARATHDALLRDTGRRPFVLSRSTFVGSGRYTAHWTGD
NFATWDDLRYSINTMLSFGLFGIPMIGADICGFGGNTTEELCSRWIQLGAFYPFSRDHSA
IGTVRRELYLWESVARSARKALGLRYRLLPYLYTLMYEAHTTGAPIARPLFFSYPGDVAT
YGIDRQFLLGRGVLVSPVLEPGATTVTAYFPAGRWFSLYDFSLAVATKTGKRVTLPAPAD
TVNVHVAGGNILTLQQPALTSSRVRQSVVHLLVALAEDGTATGDLFLDDGESPEMVGARS
RWSQIKFSGATESGGSVVRVRSHVVHDSYAPSRTMVIAKVVLMGLRSPVPPKGFAVYANG
VQVNASTAVDGGGGGNPEKGALGVAHVGGLSLVVGQEFDLKVVMTY
NT seq 2661 nt   +upstreamnt  +downstreamnt
atggcgacgagagctcggccgccattggtgctattgctgtgtctctgcttggcttcttgc
ttgagctcggccattggtggcgtttcagctgccggcaatggctaccggaccacggcattc
ctggtggatgaggaagggaggcggctcagagccgagctcgccgcagtcgccggcgccggc
ggcgggtccacggcggcgtacggcgacgacgtgcagaggctagacgtgtatgccagcctg
gagacggacagccggctgcacgttcgcatcgccgacgccgacggcccgcgatgggaggtg
ccccaggacgtcatcccgcgcccctcgccggagttcttcctccagacgtcgcgtccgggc
cggcccgtcctctccacggcgacctccgacctcaccttcgccatccacgcctcctccccg
ttccgcttcgccgtctcccgccgctccactggcgacgtcctcttcgacacctcccccaac
ctcgtcttcaaggatcgctacctcgagctcacctcctcgctgccgccgcccggccgcgcg
tcgctgtacggcctcggcgagcagaccaagcgcacgttccggctccagcggaatgacacc
ttcacgctctggaactccgacatcgccgccggcaacgtcgacctcaacctctacggctcc
caccccttctacatggacgtccggtcaggcggcggcggcgcggcgcacggcgtgctcctc
cttaacagcaacggcatggacgtcatctatggtggatcgtacgtcacctacaaggtgatc
ggcggcgtgctggatttctacttcttcgccggcccgtcccctctcgccgtcgtcgaccag
tacacccagctcatcggccgccctgcccccatgccgtactggtcattcgggttccaccag
tgcaggtgggggtacaagaacgtgtctgacctggagggcgtggtcgccggctatgccaag
gcgaggatcccgctggacgtgatgtggacggacatcgactacatggacgccttcaaggac
ttcacgcttgatccggcgaacttcccggccgacctgctccggccgttcgtcgaccgcctc
caccgcaacggccagaagtacgtcgtcatcattgacccagggatcagtgtgaacgcgacg
tacgggacgttcatccgagcgatcaaggaggacatcttcttgaagtggaacgggagtaac
tacctcggtgtggtgtggccggggaacgtctccttcccggacttcctcaacccgcgcgcc
gccgagttctgggcgcgcgagatcgccgcgttccggcggaccctccccgtcgacgggctg
tggatcgacatgaacgagatctccaacttcgtcgacccgccgccgctcaacgcgctcgac
gacccgccgtaccgcatcgacaactccggcgtgcgccgccccatcaacaacaagacggtg
ccggcctccgccgtgcactacggcggcgtggccgagtacgacgcgcacaacctcttcggc
ttcctcgaggcgcgggccacgcacgacgcgctgctccgtgacaccggccgccgcccgttc
gtgctcagccgctccacgttcgtcggctccggcaggtacaccgcgcactggaccggcgac
aacttcgcgacgtgggacgacctccgctactccatcaacactatgcttagcttcggcctc
ttcggcatccccatgatcggtgccgacatctgcggcttcggcggaaacaccaccgaggag
ctctgcagccgatggattcagcttggcgcgttctacccgttctcgagggaccactcggcg
atcggcaccgtccggcgagagctgtacctgtgggaatcggtggcgaggtcggcgaggaag
gcgctcggcctgcgctaccggctgctcccctacttgtacacgctcatgtacgaggcgcac
accacgggcgcgcccatcgcgcggccgctcttcttctcctaccccggcgacgtcgcgacg
tacggcatcgacaggcagttcctgctcggccgcggcgtgctcgtgtcaccggtgctcgag
ccgggcgcgaccaccgtcaccgcctacttcccggcgggacggtggttcagcctctacgac
ttctccctcgccgtcgccacgaagaccggcaagcgcgtgacgctgcccgcgccggcggac
acggtgaacgtgcacgtcgccggcgggaacatcctgacgctgcagcagcccgcgctgacg
tcgtcgcgcgtgcgccagagcgtggtccacctcctggtcgccctcgccgaggacggcacg
gccaccggggatctcttcttggacgacggcgagtcgccggagatggtcggggcgcggagc
aggtggagccagatcaaattcagcggcgcgaccgagagcggcggcagcgtcgtcagagtg
aggtcgcacgtggtgcacgactcgtacgcgccgagccggacgatggtcatcgccaaggtg
gtgctcatggggcttcgatcgccggtgccgcccaaggggttcgccgtttatgccaacggc
gtccaggtgaacgcgagcacggcggtcgacggcggcggcggcgggaacccggagaaggga
gcgctgggcgtggcgcacgtcggcgggctgtcgctggtcgtcgggcaggagttcgatctc
aaggtcgttatgacctattaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4343975
Entry
4343975           CDS       T01015                                 
Name
(RefSeq) 4-alpha-glucanotransferase DPE1, chloroplastic/amyloplastic
  KO
K00705  4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00500  Starch and sucrose metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    4343975
Enzymes [BR:osa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     4343975
SSDB
Motif
Pfam: Glyco_hydro_77
Other DBs
NCBI-GeneID: 4343975
NCBI-ProteinID: XP_015645120
UniProt: Q8LI30 F2ZBU6
LinkDB
Position
7:25980430..25984856
AA seq 594 aa
MATLSLPLPHLTQAIPARARPRPRPLRGIPARLLSCRAAMAVAPDKEEAAAVALDKAVKV
AVAAPDRAAVAAVGVGEELPEGYDQMMPAVEEARRRRAGVLLHPTSLRGPHGIGDLGDEA
VAFLAWLRDAGCTLWQVLPLVPPGRKSGEDGSPYSGQDANCGNTLLISLEELVKDGLLME
NELPDPLDMEYVEFDTVANLKEPLIAKAAERLLLSRGELRTQYDCFKKNPNISGWLEDAA
LFAAIDRSIDALSWYEWPEPLKNRHLRALEDIYQKQKDFIEIFMAQQFLFQRQWQRIRKY
AKKLGISIMGDMPIYVGYHSADVWANRKSFLLDKNGFPTFVSGVPPDAFSETGQLWNSPL
YDWKAMEAGGFEWWIKRINRALDLYDEFRIDHFRGLAGFWAVPSESKVALVGSWRAGPRN
AFFDALFKAVGRINIIAEDLGVITEDVVDLRKSIEAPGMAVLQFAFGGGSDNPHLPHNHE
FDQVVYTGTHDNDTVIGWWQTLPEEEKQTVFKYLPEANRTEISWALITAALSSVARTSMV
TMQDILGLDSSARMNTPATQKGNWRWRMPSSVSFDSLSPEAAKLKELLGLYNRL
NT seq 1785 nt   +upstreamnt  +downstreamnt
atggctaccctctccctccctctcccgcatctcacccaggccatccccgcgcgagcgcgt
ccgcgaccgcgaccgctccgtgggatccccgcgcggctcctctcctgccgcgccgcgatg
gcggtggcgcccgacaaggaggaggcggcggcggttgctctggacaaggcggtgaaggtg
gcggtggcagctcccgacagggcggcggtggccgcggtgggcgtcggggaggagctcccc
gaggggtacgaccagatgatgccggccgtggaggaggcgcggcggcggcgagccggggtg
ctgctgcacccgacctcgctccgcggcccgcacggcatcggcgacctcggcgacgaggcg
gtcgccttcctcgcctggctccgcgacgccggctgcacgctctggcaggttcttccgctt
gttccaccgggaaggaagtctggggaggatggctctccatattcaggacaggatgcaaac
tgtggtaataccctattaatttcacttgaagagcttgtaaaagatgggttgttgatggag
aatgaactacctgaccccttggatatggagtatgttgaatttgacaccgttgccaatctg
aaagaacctcttattgcaaaggctgcagagaggctcctactgagccgtggagagctcaga
acgcaatatgactgcttcaagaaaaatccaaatatttcaggttggcttgaagatgctgca
ctttttgctgctattgacagaagtattgatgcattatcctggtatgagtggcctgaacct
ctgaaaaaccgacatctcagggccttggaagacatatatcaaaaacagaaggatttcata
gagatatttatggctcaacaattcttatttcaaaggcagtggcagcgaattcgtaaatat
gcaaagaagttgggtatcagcataatgggtgacatgcccatatatgttggctaccatagt
gcagatgtttgggcaaacaggaaatcgtttttgctggacaagaatggttttccgactttt
gttagtggtgttccacctgatgcatttagtgaaactggtcagctttggaacagtccattg
tacgactggaaagctatggaagcaggtggatttgaatggtggataaaaaggattaatcgt
gcccttgatttgtatgatgagttccgtatagaccatttccgggggcttgcaggtttttgg
gcagttccttctgagtcaaaagtagcgctggttggaagctggagggctggaccgaggaat
gcattttttgatgcattattcaaagctgtcggtagaataaacataatagcagaagacctg
ggggtgataacagaagatgttgttgacctaaggaagtctattgaggctcctggaatggca
gttcttcagtttgcttttggcggtggttctgacaatccacacttgccccataaccatgaa
tttgatcaagtagtatacaccggaacacacgacaatgacacggttattggttggtggcaa
actttaccagaggaagagaagcagactgtgttcaagtatctgcctgaggctaataggact
gaaatctcatgggcactgatcactgctgccctctcttcagttgcaaggacatccatggta
accatgcaggacattcttggcctcgacagttctgctagaatgaatactccagctacacag
aaagggaactggagatggaggatgccgagctctgtcagcttcgacagcctcagccctgaa
gcggcgaagctgaaggaattgcttggactgtacaaccggctctaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4344192
Entry
4344192           CDS       T01015                                 
Name
(RefSeq) 4-alpha-glucanotransferase DPE2
  KO
K00705  4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00500  Starch and sucrose metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    4344192
Enzymes [BR:osa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     4344192
SSDB
Motif
Pfam: Glyco_hydro_77 CBM_20
Other DBs
NCBI-GeneID: 4344192
NCBI-ProteinID: XP_015647212
UniProt: Q69Q02 A0A1B0SZS5
LinkDB
Position
7:27960445..27968000
AA seq 946 aa
MTNLSGKKSLNTVTLVFKLPYYTQWGQSLLIAGSEPALGSWNVKQGLSLSPVHQGNELIW
SGRVSVATGFTCQYNYYVVDDNKNVLRSESGEKRKLVLPEGVQDGDVVEIRDWWQDASEA
LFLRSAFKNVIFNGSENAKRELKTTSLNKSLEPEDIVVQFIVSCPRLGAGSTVVVTGSNP
QLGRWQTQDGLKLNYVGDSIWKANCLLRKSEFPIKYKYCKISEAGVSSLEFGPNREADVD
LSSPKPSRYVLLSDGALRESPWRGAGVAVPIFSIRSNEDLGVGEFLDLKLLVDWAVNSGF
HLVQLLPINDTSVHGMWWDSYPYSSLSVFALHPLYLRVQALSDAIPGDIKDEISQAKKQL
DKKDVDYEASLASKLSIARKIFKLEKDKVLNSSSFKQFLSENEEWLKPYAAFCFLRDFFE
TSDHSQWGRFSQFSKEKLDKLVSEGTLHHDVICFHYYIQYHLYMQLSEAAAYARKKKVIL
KGDLPIGVDRNSVDTWVYPTLFRMNTATGAPPDYFDKNGQNWGFPTYNWEEMSKDNYGWW
RARLTQMAKYFTAYRIDHILGFFRIWELPDHAATGLVGKFRPSIALSQEELLSEGLWDFD
RMSRPYILQETLEEKFGSFWTVIAANFLNEYKKQHYEFKEDCNTEKKIIAKLKNSSEKSL
WLEKEDSIRRGLFDLLQNIVLIRDPEDSTKFYPRFNQEDTSSFNDLDEHSKNILRRLYYD
YYFARQENLWRQNALKTLPVLLNSSDMLACGEDLGLIPACVHPVMQELGLIGLRIQRMPS
EPNLEFGIPSQYSYMTVCAPSCHDCSTLRAWWEEDGGRRSRFYQTVIGSDDEPPSRCTPE
VANFIVKQHFDAPSMWAIFPLQDLLALKDKYTTRPAKEETINDPTNPKHYWRFRLHVTLD
SLLDDKDIQATIKELVTSSGRSFPGKVDGAEESGEKLAKVQLNGKP
NT seq 2841 nt   +upstreamnt  +downstreamnt
atgacgaatttgtccgggaagaaatctctgaatacagtgaccttggtcttcaaattaccc
tactacacacaatgggggcagagtcttctcatcgccggctcagagccagcacttggatct
tggaatgttaagcaaggattgtctctcagtccagttcatcagggaaatgagctaatctgg
tccggcagagtttccgtcgctactggttttacctgccagtacaattactatgtagtggac
gacaacaagaatgttttgagatcggagtccggggagaaaaggaaattagtacttccagag
ggtgttcaggatggagatgtagttgagatacgcgactggtggcaggatgcttctgaagct
cttttccttcgaagtgcattcaagaatgtcattttcaatgggtctgaaaatgctaaaaga
gaattgaagactacatccctcaacaaaagtttggagcctgaagatattgttgttcagttt
attgttagctgtccccgacttggagctggctctactgtcgtggtcacaggaagtaatcct
caattaggaaggtggcaaacacaagatggcctcaagcttaattatgtcggagattccatc
tggaaagcaaactgtctgttgcgaaagtctgagttcccaataaaatataaatactgtaaa
attagtgaagcaggagtctcttcattggagttcggtccgaacagggaggctgatgtggat
ctatcatcacccaagccatccagatacgtcctcttgtctgatggtgcccttcgggaatca
ccatggaggggtgcaggtgttgctgtacctatattctcgatcaggtcaaatgaggacctt
ggtgttggagaattccttgatcttaaacttcttgttgactgggcagtcaactcaggcttt
catcttgttcagcttcttcctatcaatgatacttcagttcacgggatgtggtgggattca
tacccatacagctcgctctctgtgtttgcattgcaccccttgtacctgagagtacaagca
ctttcagatgcaattccaggggatattaaggacgagatttcacaggcaaagaagcagttg
gacaaaaaggatgttgactatgaggcatcactggcctcaaaactctcgatagcaagaaaa
atattcaaattagagaaagacaaagtactaaattccagttcgttcaagcagtttttatct
gaaaacgaggagtggttgaaaccatatgctgcattttgttttctgcgggacttctttgag
acatcagatcacagccaatggggccgtttttctcagttttccaaggagaagctagataag
cttgtttctgaaggtaccttgcaccatgacgttatatgtttccattactacatccagtac
catctatatatgcaattatcagaggcagctgcctatgcaaggaagaaaaaggttattctg
aaaggagatttacctattggtgttgataggaatagtgtggatacttgggtataccccact
ttatttcgcatgaatacagctactggtgcacctccagattatttcgacaaaaatggacaa
aattggggttttcctacatataactgggaggaaatgtcaaaggataattatgggtggtgg
cgagctcgtctgacacagatggcaaaatacttcactgcatataggatagaccatatcttg
ggtttctttaggatatgggagcttccagatcatgcagccacaggtctagttgggaaattt
aggccttcaattgctctcagtcaggaggagcttcttagtgaaggcctatgggatttcgat
agaatgagccgcccttatattcttcaggaaacactggaggagaagtttgggtccttttgg
acagtaattgcagctaactttctaaatgagtacaagaaacaacattacgagttcaaagag
gactgcaatacagagaaaaagataattgcaaagcttaagaacagttctgaaaaatcatta
tggctggagaaagaagacagcattcggcgtggtttgtttgatctactacagaatatagtc
cttattagagatccagaggacagcacaaaattttatccccgcttcaaccaggaggatact
tcaagttttaacgatctagatgaacatagcaaaaatatcctcagaagattgtactatgac
tattattttgctcgccaagagaatctctggcgtcaaaatgcgctcaagactctgcctgtg
cttttgaactcatcggatatgttggcatgtggggaagatcttggccttatccctgcctgt
gttcaccctgttatgcaagaacttggattgattggattgcgtatccagagaatgcccagt
gaaccaaacttggaatttggtattccatctcagtatagctacatgacggtttgtgctccg
tcatgtcatgattgctccacattacgtgcttggtgggaagaagatggaggaagaagaagc
cgtttctaccagactgtaattggtagtgatgacgagccgccatctcgctgcaccccagaa
gtagcgaactttattgttaagcagcattttgatgctccatcaatgtgggcaatcttccca
ctacaggacctgcttgcacttaaagacaagtacaccacaagaccagcaaaagaggaaaca
atcaatgacccaactaacccgaagcattattggagattccggctacatgtgacattggat
tcgctgttggacgataaggacatccaagcaaccatcaaggaacttgtcacaagtagtggg
aggtcatttcctggtaaggtggatggcgccgaagaaagcggagagaagctagctaaagtc
cagttgaatggtaaaccatag

DBGET integrated database retrieval system