KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4341869
Entry
4341869           CDS       T01015                                 
Name
(RefSeq) 50S ribosomal protein L24, chloroplastic
  KO
K02895  large subunit ribosomal protein L24
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4341869
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4341869
Ribosome [BR:osa03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    4341869
  Bacteria
    4341869
  Archaea
    4341869
SSDB
Motif
Pfam: ribosomal_L24 KOW
Other DBs
NCBI-GeneID: 4341869
NCBI-ProteinID: XP_015641647
UniProt: B9FQJ2 Q653V9
LinkDB
Position
6:complement(28472596..28474788)
AA seq 190 aa
MAGVAALQGAMASLSISAPGAASTSSFWGHPLSTFAAAPAGVKFMIKTCPIQMRLKRWER
KKCKPNSLPVLHKMHVRIGDTVQVIAGREKGKVGEVTRLFKHNSTVIVKDLNLKSKHKKG
TEDEPGEIVMIEGPIHSSNVMLYSKEKNVASRVGHKFLEDGTKVRYLVKTGEIIDSAENW
VKVFKEGSSE
NT seq 573 nt   +upstreamnt  +downstreamnt
atggccggggtggcggcgttgcagggcgcgatggcgtccctctccatctctgcgccgggg
gcggcgagcaccagcagcttctggggccacccgctctccaccttcgccgccgcgccggct
ggggttaaatttatgatcaagacatgcccaattcaaatgaggcttaagcgatgggagagg
aagaagtgtaaaccaaacagtcttcctgtcctgcacaagatgcatgttaggattggcgat
acagtacaagtcattgcaggccgtgagaaaggtaaagttggagaagttacgcggcttttt
aagcacaacagcactgtaatagtgaaggacttgaacttgaagtccaagcacaagaaagga
acagaagatgaaccgggtgaaatcgtcatgattgaaggccccattcacagctcaaatgtg
atgctctactcaaaggaaaagaatgtggcgagtagggttggacacaaattccttgaggat
ggaacgaaggttcggtacctggtcaagactggtgaaataattgacagtgctgagaattgg
gtcaaggtgttcaaggaaggaagttcggagtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4349726
Entry
4349726           CDS       T01015                                 
Name
(RefSeq) 50S ribosomal protein L24
  KO
K02895  large subunit ribosomal protein L24
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4349726
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4349726
Ribosome [BR:osa03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    4349726
  Bacteria
    4349726
  Archaea
    4349726
SSDB
Motif
Pfam: ribosomal_L24 KOW
Other DBs
NCBI-GeneID: 4349726
NCBI-ProteinID: XP_015615162
UniProt: B9G9B6 Q2RAS9
LinkDB
Position
11:complement(1813627..1816754)
AA seq 159 aa
MGWKAAEKLIRHWKILRGDNVMIIRGKDKGESGLIKRVIRSQNRVIVEGKNLVKKHIKQG
EGHTGGIFSIEAPLHVSNVQVLDPVTGKPCKIGYKYLEDGTKVRFARGMNASGAVIPRPE
ILKERRKPRPTSPGPKDTPIEHVLEKTYDAKAGIGMPDL
NT seq 480 nt   +upstreamnt  +downstreamnt
atggggtggaaggctgccgagaagctcatcaggcactggaagatcctccgcggtgacaac
gtgatgattataagaggcaaggacaagggggagagcgggctcatcaagcgggtcatccgg
tcgcagaaccgtgtcatcgtcgagggaaagaatttggttaagaaacatatcaagcaagga
gaaggacatacaggtgggattttctcaattgaagctccacttcatgtttcaaatgttcaa
gtacttgatccagtcactgggaaaccatgtaagattggatacaagtatttggaagatggg
actaaagtcaggtttgctagaggaatgaatgcatctggtgctgtgatacccaggccagaa
attttgaaggagcgaagaaagccaagacctacatcacctggcccaaaggatacaccaatt
gagcatgtgctggagaaaacctatgatgccaaggctggaattgggatgcctgatctatag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4351443
Entry
4351443           CDS       T01015                                 
Name
(RefSeq) 50S ribosomal protein L24 isoform X1
  KO
K02895  large subunit ribosomal protein L24
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4351443
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4351443
Ribosome [BR:osa03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    4351443
  Bacteria
    4351443
  Archaea
    4351443
SSDB
Motif
Pfam: ribosomal_L24 KOW
Other DBs
NCBI-GeneID: 4351443
NCBI-ProteinID: XP_015618313
LinkDB
Position
12:complement(1747197..1750138)
AA seq 188 aa
MGWKAAEKLIRHWKILRGDNVIIFPRPRIPLRPSPLSSKISNFGAVYFQVMIIRGKDKGE
SGLIKRVIRSQNRVIVEGKNLVKKHIKQGEGHTGGIFSIEAPLHVSNVQVLDPVTGKPCK
IGYKYLEDGTKVRFARGMNASGAVIPRPEILKERRKPRPTSPGPKDTRIEHVLEKTYDAK
AGIGMPDL
NT seq 567 nt   +upstreamnt  +downstreamnt
atggggtggaaggctgcggagaagctcatcagacactggaagatcctccgcggtgacaac
gtaattatctttccccgtcctcgcattcctcttcgcccctctcctctttctagcaaaatc
tccaatttcggcgctgtttatttccaggtgatgatcataagaggcaaggacaagggggag
agcgggctcatcaagcgggtcattcggtcgcagaaccgtgtcatcgtcgagggaaagaat
ttggttaagaaacatattaagcaaggagaaggacatacaggtgggattttctcaattgaa
gctccacttcatgtttcaaatgttcaagtacttgatccagtcactgggaaaccatgtaag
attggatacaagtatttggaagatggaactaaagtcaggtttgctagaggaatgaatgca
tctggtgctgtgatacccaggccagaaattttgaaggagcgaagaaagccaagacctaca
tcacctggcccaaaggatacacgaattgaacatgtgctggagaaaacctatgatgccaag
gctggaattgggatgcctgatctatag

DBGET integrated database retrieval system