KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4341957
Entry
4341957           CDS       T01015                                 
Name
(RefSeq) macrophage migration inhibitory factor homolog
  KO
K07253  phenylpyruvate tautomerase [EC:5.3.2.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00350  Tyrosine metabolism
osa00360  Phenylalanine metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    4341957
   00360 Phenylalanine metabolism
    4341957
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4341957
Enzymes [BR:osa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.2  Interconverting keto- and enol-groups
    5.3.2.1  phenylpyruvate tautomerase
     4341957
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   4341957
SSDB
Motif
Pfam: MIF
Other DBs
NCBI-GeneID: 4341957
NCBI-ProteinID: XP_015643567
UniProt: Q5Z858 Q0D9T7
LinkDB
Position
6:complement(29402742..29403736)
AA seq 115 aa
MPQLSLTTNVPVDAVVAADIIKDCSKALARIIGKPESYVMVSISGSVPMSFAASEEPAAY
GELMSIGGIGPGVNGKLSAALAEILETKLSVSRSRFYVKFDDVKGFNLGFNGSTF
NT seq 348 nt   +upstreamnt  +downstreamnt
atgccgcagctgagcctgaccaccaacgtgcccgtcgacgccgtcgtcgccgccgacatc
atcaaggactgctccaaggcgctcgccaggatcatcggcaagcccgaatcctacgtcatg
gtgtcgatcagcgggtcggtgcccatgtcgttcgccgccagcgaggagccggcggcctac
ggcgagctcatgtccattggcggcatcggccccggcgtcaacggaaagctgagcgccgct
ctcgccgagatcctcgagaccaagctctccgtcagcaggtctaggttctacgtcaaattt
gacgatgtcaagggattcaatttggggttcaatgggtcgacattctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4349563
Entry
4349563           CDS       T01015                                 
Name
(RefSeq) macrophage migration inhibitory factor homolog isoform X1
  KO
K07253  phenylpyruvate tautomerase [EC:5.3.2.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00350  Tyrosine metabolism
osa00360  Phenylalanine metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    4349563
   00360 Phenylalanine metabolism
    4349563
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4349563
Enzymes [BR:osa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.2  Interconverting keto- and enol-groups
    5.3.2.1  phenylpyruvate tautomerase
     4349563
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   4349563
SSDB
Motif
Pfam: MIF
Other DBs
NCBI-GeneID: 4349563
NCBI-ProteinID: XP_015616909
UniProt: Q2RBL5 B9GBF2
LinkDB
Position
11:352205..355243
AA seq 121 aa
MPCLNVSTNVNLDGVDTSAVLADASKTVATIIGKPEAYVMVVLKGSVPMAFGGTQEPAAY
GELVSIGGLNPDVNKKLSAGIASILESKLSIPKGRFYLKFYDSKAHRAQEHAQCLHALHQ
E
NT seq 366 nt   +upstreamnt  +downstreamnt
atgccttgcctcaacgtgtccaccaacgtgaacctcgacggagtggacacctccgccgtc
ctcgccgacgcatccaagaccgtcgccaccatcatcggcaagcccgaggcctatgtgatg
gttgttctcaagggttcagtgcctatggcatttggaggtacccaggagcctgccgcttat
ggcgagctggtttccattggtgggctgaaccctgatgtcaacaagaagttgagtgctggc
attgcctctatcctggagtcaaagctatccattcccaagggccgcttctacctcaagttc
tacgattccaaggcccatcgtgcacaagaacatgctcaatgtttgcatgctttgcatcaa
gaatag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4351273
Entry
4351273           CDS       T01015                                 
Name
(RefSeq) macrophage migration inhibitory factor homolog isoform X1
  KO
K07253  phenylpyruvate tautomerase [EC:5.3.2.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00350  Tyrosine metabolism
osa00360  Phenylalanine metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    4351273
   00360 Phenylalanine metabolism
    4351273
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4351273
Enzymes [BR:osa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.2  Interconverting keto- and enol-groups
    5.3.2.1  phenylpyruvate tautomerase
     4351273
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   4351273
SSDB
Motif
Pfam: MIF
Other DBs
NCBI-GeneID: 4351273
NCBI-ProteinID: XP_015619646
UniProt: Q2RBL5 B9GBF2
LinkDB
Position
12:411234..414106
AA seq 121 aa
MPCLNVSTNVNLDGVDTSAVLADASKTVATIIGKPEAYVMVVLKGSVPMAFGGTQEPAAY
GELVSIGGLNPDVNKKLSAGIASILESKLSIPKGRFYLKFYDSKAHRAQEHAQCLHALHQ
E
NT seq 366 nt   +upstreamnt  +downstreamnt
atgccttgcctcaacgtgtcgaccaacgtgaacctggatggggtggacacctccgccgtc
ctcgccgacgcctccaagaccgtcgccaccatcatcggcaagcccgaggcctatgtgatg
gttgttctcaagggttcagtgcctatggcatttggaggtacccaggagcctgccgcttat
ggcgagctggtttccattggagggctgaaccctgacgtcaacaagaagctgagtgctggc
attgcctctatcctggagtcaaagctgtccattcccaagggccgcttctatctcaagttc
tacgattccaaagcccatcgtgcacaagaacatgctcaatgtttgcatgctttgcatcaa
gaatag

DBGET integrated database retrieval system