KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4342073
Entry
4342073           CDS       T01015                                 
Name
(RefSeq) BRCA1-A complex subunit BRE
  KO
K12173  BRCA1-A complex subunit BRE
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    4342073
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:osa04121]
    4342073
   03036 Chromosome and associated proteins [BR:osa03036]
    4342073
   03400 DNA repair and recombination proteins [BR:osa03400]
    4342073
Ubiquitin system [BR:osa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   BRCC complex
    4342073
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   BRISC complex
    4342073
Chromosome and associated proteins [BR:osa03036]
 Eukaryotic type
  Centrosome formation proteins
   Microtubules and associated factors
    BRISC complex
     4342073
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    BRCA1-A complex
     4342073
SSDB
Motif
Pfam: BRE
Other DBs
NCBI-GeneID: 4342073
NCBI-ProteinID: XP_015641186
UniProt: Q5Z9P5 A0A0P0X0Z6
LinkDB
Position
6:complement(30376339..30381343)
AA seq 388 aa
MSPPADTAALASTSGAPLAPLVAAQLNFVLSQANLPIRVGQIWSGCRDGRYADRFTLAIP
FCLDYVYWDFLYNALSPKVAPDVVFGPDDEGFQPLVDFDETGSGEKSCLANWDCRDTSAL
LSLIKELREFYIEYQKKRAAEVDDARLKFEISTVLSKEGIEVCTVSSNGRPDEVKFAVPL
LDLDLAKLVPGCPWKLPQKIHLQAVFPISRSYSSVPSAPRLKLVSTPDLKSFFSVDDVKL
PPWLDGMCMAEYLPNLEENLKIQVVEASASIGSRRRFIEALAPTFGRPLEADPIFCRKAT
ILSISGIFTFLVHFVIPLQFPKHQPVLTLESSQHFNAQGLPIMSAPVNDYPWSPRWDPTE
MVERIYDFLVDECQTFKKFCSDSIPQQK
NT seq 1167 nt   +upstreamnt  +downstreamnt
atgtctccgccggccgacaccgccgcgctcgcctccacgtccggcgccccgctcgcgccc
ctcgtcgccgcccagctcaacttcgtcctctcccaagccaacctccccatcagggtgggg
cagatctggtccggatgccgcgacggccgctacgccgatcgcttcacgctcgccatcccc
ttctgcctcgactacgtctactgggacttcctgtacaatgcgctgtcgccgaaggtggcg
ccggatgtggtgttcggcccggacgacgaggggtttcagccgctagtcgatttcgatgag
accgggagtggggagaagagctgcttggcaaattgggattgccgggacacctcggccctc
ctctctctcatcaaagagctccgtgaattttatattgaataccaaaagaagcgggcagcc
gaggttgatgacgcaagactgaaatttgaaataagcacagttctgtctaaggaggggatt
gaagtctgcacggtatcgtccaatggtagaccagatgaggtgaaatttgctgtcccactt
ctggatctggaccttgccaaactggttcctggatgtccttggaaacttcctcaaaagatc
catttgcaggctgtttttccaattagcagaagttactcctctgttccttctgcaccacga
ctcaaattagtctcaaccccagatttgaagtcatttttctcagttgatgatgttaaactc
cctccatggttagatggaatgtgcatggctgagtatcttcctaacttggaagaaaatctt
aaaatccaggttgtggaagcatcagcttcaattggttctagaagacgtttcattgaagca
ttggctcctacttttggaaggccattagaggctgatccgattttttgcagaaaagctacg
attctttccatctcagggattttcacttttctggtccactttgtcattcccctccaattc
cctaagcatcaacctgtgctgacattagagagttctcagcacttcaatgcccaggggtta
cctatcatgtcagctccagtaaatgactatccctggagccctagatgggatccaacagaa
atggttgaacgcatctatgactttttggttgacgagtgccaaactttcaagaagttttgc
agcgattctatccctcaacagaagtag

DBGET integrated database retrieval system