KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4342077
Entry
4342077           CDS       T01015                                 
Name
(RefSeq) endoplasmin homolog
  KO
K09487  heat shock protein 90kDa beta
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04141  Protein processing in endoplasmic reticulum
osa04626  Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    4342077
 09150 Organismal Systems
  09159 Environmental adaptation
   04626 Plant-pathogen interaction
    4342077
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:osa03110]
    4342077
Chaperones and folding catalysts [BR:osa03110]
 Heat shock proteins
  HSP90
   4342077
SSDB
Motif
Pfam: HSP90 HATPase_c HATPase_c_3 Zip
Other DBs
NCBI-GeneID: 4342077
NCBI-ProteinID: XP_015642502
UniProt: A0A0P0X0Y5 Q5Z9N8 Q8SB39
LinkDB
Position
6:complement(30444503..30450492)
AA seq 812 aa
MRKWALSSALLLLLLLLTTLPDPAKKLQVNADDSTDELVDPPKVEEKIGGVPHGLSTDSE
VVQREAESISRKTLRSSAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKI
RFLALTDKEVLGEGDTAKLEIQIKLDKEKKILSIRDRGIGMTKEDLIKNLGTIAKSGTSA
FVEKMQTGGDLNLIGQFGVGFYSVYLVADYVEVISKHNDDKQHVWESKADGSFAISEDTW
NEPLGRGTEIRLHLRDEAKEYVEEDKLKDLVKKYSEFINFPIYLWATKEVDVEVPADEDE
SSESSEEEESSPESTEEEETEESEEKKPKTKTVKETTTEWELLNDVKAIWLRSPKEVTEE
EYTKFYHSLAKDFGDDKPLSWSHFTAEGDVEFKALLFVPPKAPHDLYESYYNSNKSNLKL
YVRRVFISDEFDELLPKYLSFLKGLVDSDTLPLNVSREMLQQHSSLKTIKKKLIRKALDM
IRKLAEEDPDEYSNKDKTDEEKSAMEEKKGQYAKFWNEFGKSVKLGIIEDATNRNRLAKL
LRFESTKSEGKLASLDEYISRMKPGQKDIFYITGSSKEQLEKSPFLERLTKKNYEVIYFT
DPVDEYLMQYLMDYEDKKFQNVSKEGLKLGKDSKLKDLKESFKELTDWWKKALDTESVDS
VKISNRLSDTPCVVVTSKYGWSANMEKIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKE
LRDKVAQDSESESLKQTAKLVYQTALMESGFNLPDPKDFASSIYRSVQKSLDLSPDAAVE
EEEEVEEAEVEEKESSNIKEEAEPSSYDKDEL
NT seq 2439 nt   +upstreamnt  +downstreamnt
atgcgcaagtgggcgctctcctccgcgctcctcctcctcctcctcctcctcaccacactc
cccgatccagctaagaagctccaagtcaatgctgatgacagcactgatgagttagttgat
ccgccgaaggtagaggagaagattggtggtgttccccatggcctgtccacggactctgag
gttgttcagagggaggctgagtcaatctcgaggaagaccctcaggagctcagcggagaaa
tttgagttccaggctgaggtgtccagactcatggacatcatcatcaactcactctacagc
aacaaggacattttcctgagggagctcatctccaatgcttctgatgctttggacaagatt
aggttcctggctctcactgataaggaggttttgggcgaaggtgacactgctaagcttgaa
atccagattaagctggataaggagaagaagattctctccattcgggataggggtattggt
atgaccaaggaagatctcattaagaaccttgggaccattgccaaatctggaacttcagct
tttgtggaaaagatgcagactgggggtgacctcaatctcattgggcaattcggtgttggt
ttctattcagtatacttggttgctgactatgttgaagtgatcagcaagcacaatgacgac
aaacagcatgtctgggagtccaaagctgatggatcattcgctatctctgaggatacatgg
aatgaacccctgggccgtggaactgaaataagactgcacctccgagatgaagccaaggag
tacgtggaagaagacaagctaaaggatttggtgaagaagtactctgagttcatcaatttc
cccatttacttgtgggcaaccaaggaggttgatgtggaagtgccagctgatgaggatgag
tcaagtgaatcaagtgaagaagaggaatcatcccctgagtctacagaggaagaagagaca
gaagagagtgaagagaagaagcccaagacaaagacagtaaaggaaaccactactgagtgg
gagcttctgaatgatgtgaaggctatatggcttcgtagccctaaggaggttactgaagaa
gaatacacaaagttttaccactcacttgctaaggactttggtgatgacaagcccttgtct
tggagccacttcactgctgagggagatgttgagttcaaagctttgctctttgttcctccc
aaggctccacatgatctctatgagagttactacaactctaacaagtcaaaccttaagttg
tatgttagaagggttttcatctctgatgaatttgatgagcttcttccgaagtatctcagc
tttttgaagggtctcgtcgactcggacacattgcctctcaatgtatcacgagaaatgctc
caacaacatagcagcctgaagaccatcaagaagaaactaatccgcaaagctcttgacatg
attagaaaacttgctgaggaagatcctgatgagtacagcaacaaagataagacagatgaa
gaaaaaagtgcaatggaggagaaaaagggccagtatgccaagttctggaatgagtttgga
aaatcagtcaagttgggcatcattgaagacgcaactaacaggaaccgtcttgcaaagctt
ctgagatttgaaagtaccaagtcggaaggcaaacttgcctctcttgatgagtacatttca
aggatgaagccagggcagaaggacatcttttacattaccggaagcagcaaggaacaatta
gagaaatcaccgttccttgagaggctaaccaaaaagaactacgaggttatctacttcact
gaccctgttgacgagtacttgatgcaatacctcatggactacgaggacaagaagttccag
aacgtctccaaggagggtctcaaactcggcaaggactctaagctcaaggacctcaaggag
tccttcaaggagctgaccgactggtggaagaaggctcttgacaccgagagcgtggactcg
gtgaagatcagcaaccggctgagcgacaccccctgcgtggtggtgacatccaagtacggg
tggagcgccaacatggagaagatcatgcagtcacagaccctctcggatgccagcaagcag
gcgtacatgcgcggcaagagggtactcgagatcaaccccaggcaccccatcatcaaggaa
ctccgtgacaaggtcgcccaggacagcgagagcgagagcttgaagcagacggcgaagctg
gtgtaccagacggccctcatggagagcggcttcaaccttcctgatcccaaggacttcgcc
tccagcatctacaggtcggtgcagaagagccttgacctgagccccgacgcggccgtggaa
gaggaagaggaggtcgaggaggccgaggttgaagagaaggaatcatccaacatcaaggag
gaggcggagccgtcgtcgtatgataaggacgagctgtag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4345893
Entry
4345893           CDS       T01015                                 
Name
(RefSeq) heat shock protein 90-5, chloroplastic
  KO
K09487  heat shock protein 90kDa beta
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04141  Protein processing in endoplasmic reticulum
osa04626  Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    4345893
 09150 Organismal Systems
  09159 Environmental adaptation
   04626 Plant-pathogen interaction
    4345893
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:osa03110]
    4345893
Chaperones and folding catalysts [BR:osa03110]
 Heat shock proteins
  HSP90
   4345893
SSDB
Motif
Pfam: HSP90 HATPase_c HATPase_c_3 DUF6225
Other DBs
NCBI-GeneID: 4345893
NCBI-ProteinID: XP_015650272
UniProt: Q0J4U8 Q6ZCV7
LinkDB
Position
8:complement(24122830..24129498)
AA seq 785 aa
MAPSLSRSLGASSVAALRPCAGRVRAPGAGAARGSGSARCGRGVRWEAGSGSRGRLVRVR
CDAAVAEKAEETAEEEKFEYQAEVSRLMDLIVHSLYSHKEVFLRELVSNASDALDKLRFL
GVTDSSLLADGGELEIRIKPDPDAGTITITDTGIGMTKDELKDCLGTIAQSGTSKFLKAL
KENKDLGADNGLIGQFGVGFYSAFLVAEKVVVSTKSPKSDKQYVWEGVADSSSYVIKEET
DPEKMLTRGTQITLVLRPDDKFEFADPGRIQGLVKNYSQFVSFPIYTWQEKSRTVEVEED
EEAKEGEEAKEGEQKKKKTITEKYWDWELANETKPIWMRSPKEIEKTEYNEFYKKAFNEF
LDPLAYTHFTTEGEVEFRSVLYIPGMAPLSNEEIMNPKTKNIRLYVKRVFISDDFDGELF
PRYLSFVKGVVDSNDLPLNVSREILQESRIVRIMRKRLVRKTFDMIEEISEKDDKEDYKK
FWESFGKFIKLGCIEDTGNHKRLAPLLRFHTSKNEGDLISLDQYVENMPENQKAIYYIAT
DSLQSAKTAPFLEKLVQKDIEVLYLIEPIDEVAIQNLQTYKEKKFVDISKEDLELGDEDE
DNKESKQEYTLLCDWVKQQLGDKVAKVQISKRLSLSPCVLVSGKFGWSANMERLMKAQTL
GDTSSLEFMRGRRIFEINPDHPIVKDLNAACKNEPESTEAKRAVELLYETALISSGYTPD
SPAELGGKIYEMMTIALGGRWGRSDTETEAATTGDASTETGSSEATVTEVIEPSEVRPES
DPWRD
NT seq 2358 nt   +upstreamnt  +downstreamnt
atggcgccttcgctgagcaggagcctgggggcgtcgtcggtggcggcgctgcggccgtgc
gcggggagggttagggcgccgggggcgggcgcggcgcgggggagcgggtcggcgaggtgc
gggagaggggtgaggtgggaggcggggagcgggagcagggggagactggtgcgggtgagg
tgcgacgccgccgtcgcggagaaggccgaggagacggcggaggaggagaagttcgagtac
caggcggaggttagccgcctaatggatttgattgtccatagcctttacagccacaaggaa
gtatttcttcgggagcttgtgagtaatgcgagtgacgcattggataagctgaggtttctt
ggtgtgactgattcttctctccttgctgatggcggcgagttggagataaggattaaacca
gaccctgatgcaggaaccataactattactgatactggcattggaatgaccaaagatgaa
cttaaggattgccttggtactattgctcagagtggcacctcaaaatttttgaaggctcta
aaggagaataaagaccttggagccgataatggtctgattggccagtttggggttgggttt
tactcagcttttcttgtagcggaaaaggttgtggtctccactaagagccccaaatcagat
aagcaatatgtatgggaaggtgtagctgacagtagctcttatgtcatcaaggaagagact
gatcctgaaaaaatgcttacacgtggcactcagattactctcgttttaaggcctgatgat
aagtttgagtttgctgatcctggaaggattcaaggcctagttaagaactactctcagttt
gtgtctttccccatatacacatggcaggaaaaatccagaactgtcgaggttgaagaggat
gaagaggcaaaagaaggtgaagaggcgaaagagggtgaacaaaagaaaaagaagacaatt
actgagaaatactgggattgggagctagccaatgaaacaaagcctatatggatgagaagt
ccaaaggaaattgagaaaacagaatacaatgaattttataagaaggcattcaatgagttc
ttagatcctctggcctacactcacttcacaacagagggtgaggtggaatttaggagtgtc
ctttacattccaggaatggctccgcttagtaatgaggagataatgaatccaaaaactaag
aatatccggttatatgtcaaaagagtatttatctctgatgacttcgatggtgaactgttc
cccagatacttgagctttgtaaaaggtgtagttgattcaaatgaccttcccctcaatgtt
tctcgtgagattcttcaggagagtcgaatagtaagaattatgcgaaagagacttgttagg
aagacatttgatatgattgaggagatttctgaaaaggatgacaaggaggattacaagaag
ttctgggagagctttggcaagttcatcaaacttggttgcattgaggacaccggaaatcac
aagcgtcttgcacctctgctgcgtttccacacttctaaaaatgagggagatttgataagt
cttgatcaatatgtagaaaacatgccagagaaccaaaaagcaatctattacattgctaca
gatagtctccagagtgcaaagactgctcctttcctagaaaagttggttcagaaagacatt
gaagttctctacctcattgagccaatagatgaggttgccattcagaatttgcagacctat
aaagagaagaagtttgttgatatcagcaaagaggacctggagttgggtgatgaagatgag
gacaataaggaaagcaaacaggaatacactcttctgtgtgactgggtaaaacagcagctt
ggtgacaaggtagcaaaggttcaaatatcaaagcgcctcagtttgtcaccatgtgttctt
gtatctggcaagtttggttggtctgccaacatggaaagactcatgaaagcacaaacactt
ggggacacatcaagcttggagttcatgaggggtagaaggattttcgaaattaaccctgac
caccctattgtcaaggacttgaatgctgcctgcaaaaatgagcctgaaagtacagaagct
aagagggctgttgagctgttgtatgagactgctctgatctccagtggatatactcctgac
agtcctgcggagttgggtggtaagatctatgagatgatgacaattgcccttggcgggaga
tgggggaggtcagacaccgagactgaagcagcaaccactggtgatgccagcacagagaca
ggctcatctgaagccacggtgacggaggtgattgagccttctgaagtgaggcctgagagt
gacccatggagggattaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4345951
Entry
4345951           CDS       T01015                                 
Name
(RefSeq) heat shock protein 81-1
  KO
K04079  molecular chaperone HtpG
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04141  Protein processing in endoplasmic reticulum
osa04626  Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    4345951
 09150 Organismal Systems
  09159 Environmental adaptation
   04626 Plant-pathogen interaction
    4345951
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:osa01009]
    4345951
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:osa03110]
    4345951
   04131 Membrane trafficking [BR:osa04131]
    4345951
   03051 Proteasome [BR:osa03051]
    4345951
   03029 Mitochondrial biogenesis [BR:osa03029]
    4345951
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4345951
Protein phosphatases and associated proteins [BR:osa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     4345951
Chaperones and folding catalysts [BR:osa03110]
 Heat shock proteins
  HSP90
   4345951
Membrane trafficking [BR:osa04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    4345951
Proteasome [BR:osa03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    4345951
Mitochondrial biogenesis [BR:osa03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-independent mechanism factors
    4345951
Exosome [BR:osa04147]
 Exosomal proteins
  Proteins found in most exosomes
   4345951
SSDB
Motif
Pfam: HSP90 HATPase_c HATPase_c_3 LOH1CR12
Other DBs
NCBI-GeneID: 4345951
NCBI-ProteinID: XP_015649678
UniProt: Q0J4P2 E0X6U7
LinkDB
Position
8:complement(24719149..24723563)
AA seq 699 aa
MASETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDA
QPELFIHIVPDKASNTLSIIDSGIGMTKSDLVNNLGTIARSGTKEFMEALAAGADVSMIG
QFGVGFYSAYLVAERVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGEQLGRGTKITLYLK
DDQLEYLEERRLKDLIKKHSEFISYPISLWTEKTTEKEISDDEDEEEKKDAEEGKVEDVD
EEKEEKEKKKKKIKEVSHEWSLVNKQKPIWMRKPEEITKEEYAAFYKSLTNDWEEHLAVK
HFSVEGQLEFKAVLFVPKRAPFDLFDTRKKLNNIKLYVRRVFIMDNCEELIPEWLSFVKG
IVDSEDLPLNISREMLQQNKILKVIRKNLVKKCVELFFEIAENKEDYNKFYEAFSKNLKL
GIHEDSTNRNKIAELLRYHSTKSGDELTSLKDYVTRMKEGQNDIYYITGESKKAVENSPF
LEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKRKEELKEK
FEGLCKVIKEVLGDKVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGY
MSSKKTMEINPENAIMEELRKRADADKNDKSVKDLVLLLFETALLTSGFSLDDPNTFGSR
IHRMLKLGLSIDEDETAEADTDMPPLEDDAGESKMEEVD
NT seq 2100 nt   +upstreamnt  +downstreamnt
atggcctcggagacggagacgttcgccttccaggcggagatcaaccagctgctgtcgctc
atcatcaacacgttctactccaacaaggagatcttcctccgcgagctcatctccaactcc
tccgatgcgttggacaagatcaggttcgagagcttgacggacaagagcaagctggatgct
cagccagagctgttcatccatattgttcctgacaaggcctccaacacactgtcgatcatt
gacagtggtattggtatgaccaagtcagatcttgtgaacaacctgggtaccattgccagg
tcagggactaaggagtttatggaggcactggctgctggtgctgatgtgtccatgattggt
cagttcggtgttggattctactctgcctaccttgttgccgagagagtagttgtgaccacc
aagcacaacgatgacgagcagtatgtgtgggagtctcaggctggtgggtccttcactgtc
acacgtgacacatctggggagcagcttgggaggggtactaagatcaccctctacctcaag
gatgatcagttggaataccttgaagagcgccgcctcaaggacctgatcaagaagcactct
gagtttatcagctaccctatctctctatggactgagaagaccactgagaaggaaatttct
gatgatgaagatgaggaagagaagaaggatgctgaggagggcaaggttgaggatgttgat
gaagagaaggaagaaaaggagaagaaaaagaagaagatcaaggaggtttctcatgagtgg
tccctggtcaacaaacagaagcctatctggatgaggaagcctgaggagatcactaaggag
gagtatgctgctttctacaagtccctgacaaacgactgggaggagcatcttgctgtcaag
cacttctctgtggagggtcagctggaattcaaagctgttctctttgttcccaagagggca
ccattcgacctctttgatacgaggaagaagctcaacaacatcaagctctacgtccgccga
gtcttcatcatggacaactgtgaggagctgatccctgagtggctgagctttgtcaagggc
attgttgactccgaggatcttcccctcaacatctcccgtgagatgctgcagcagaacaag
attctcaaggtcatcaggaagaaccttgtcaagaagtgcgttgagctcttcttcgagatt
gctgagaacaaggaagactacaacaagttctatgaagccttctccaagaacctcaagctc
ggtatccacgaggactccaccaacagaaacaagattgccgagctcctgaggtaccactcc
accaagagcggcgatgagctgaccagcctcaaggattacgtgacgaggatgaaggaaggc
cagaacgacatatactacatcaccggcgagagcaagaaggccgtggagaactcccccttc
ttggagaagctgaagaagaagggttacgaggtcctctacatggttgatgccatcgacgag
tatgctgttggccagctcaaggagtttgagggcaagaagctcgtctctgccaccaaggag
ggactcaagcttgatgagagcgaggacgagaagaagcggaaggaggagctcaaggagaaa
ttcgagggtctctgcaaggtcatcaaggaggtgctcggagacaaggtcgagaaggtggtg
gtctcggaccgtgtggtggactccccgtgctgcctcgtcaccggcgagtatggctggacg
gccaacatggagaggatcatgaaggcccaggcgctgagggactcgagcatggccgggtac
atgtcgagcaagaagacgatggagatcaacccggagaacgccatcatggaggagctccgc
aagcgcgccgacgccgacaagaacgacaagtccgtcaaggacctcgtcttgctcctcttc
gagacggccctcctcacctccggcttcagcctcgacgaccccaacaccttcggcagcagg
atccaccgcatgctcaagctcggcctgagcatcgacgaggacgagacggcggaggccgac
accgacatgccgccgctcgaggacgacgccggcgagagcaagatggaggaggtcgactaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4347356
Entry
4347356           CDS       T01015                                 
Name
(RefSeq) heat shock protein 90-5, chloroplastic
  KO
K09487  heat shock protein 90kDa beta
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04141  Protein processing in endoplasmic reticulum
osa04626  Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    4347356
 09150 Organismal Systems
  09159 Environmental adaptation
   04626 Plant-pathogen interaction
    4347356
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:osa03110]
    4347356
Chaperones and folding catalysts [BR:osa03110]
 Heat shock proteins
  HSP90
   4347356
SSDB
Motif
Pfam: HSP90 HATPase_c HATPase_c_3 Isochorismatase
Other DBs
NCBI-GeneID: 4347356
NCBI-ProteinID: XP_015612552
LinkDB
Position
9:complement(18150641..18155524)
AA seq 791 aa
MAPALSRSLGASSVAALRPTPSRGRGPTLRSAVAVQGRGAAAVAARGVRWEAGRRKGKGR
MVGVRCEAAVTEKPAGEEEAAGEQFEYQAEVSRLLDLIVHSLYSHKEVFLRELVSNASDA
LDKLRFLSVTDSSVLSDGGELEIRIKPDPEAGTITITDTGIGMTKDELKDCLGTIAQSGT
SKFLKALKENKDLGADNGLIGQFGVGFYSAFLVAEKVVVSTKSPKADKQYVWEAMADSSS
YVIKEETDPEKMLTRGTQITLFLRDDDKYEFADPGRIQGLVKNYSQFVSFPIYTWQEKSR
TVEVEEEEPKEGEEATEGEKKKKKKTITEKYWDWELANETKPIWMRNPKEVEKTEYNEFY
KKAFNEFLDPLAYTHFTTEGEVEFRSVLYIPGMAPLSNEEIMNPKTKNIRLYVKRVFISD
DFDGELFPRYLSFVKGVVDSNDLPLNVSREILQESRIVRIMRKRLVRKTFDMIQEIAEKE
DKEDYKKFWESFGKFVKLGCIEDTGNHKRLAPLLRFYSSKNETDLISLDQYVENMPENQK
AIYYIATDSLQSAKTAPFLEKLVQKDIEVLYLIEPIDEVAIQNLQTYKEKKFVDISKEDL
ELGDEDEDKENESKQEYTLLCDWIKQQLGDKVAKVQISNRLSSSPCVLVSGKFGWSANME
RLMKAQTLGDTSSLEFMRGRRIFEINPDHPIVKDLSAACKNEPESTEAKRAVELLYETAL
ISSGYTPDSPAELGGKIYEMMTIALGGRWGRPEESEAATSESNVEVESSEGSATEVVEPS
EVRPESDPWKD
NT seq 2376 nt   +upstreamnt  +downstreamnt
atggcgccggcgctgagcaggagcctgggggcgtcgtccgttgcggcgctgaggccgacc
ccgtcgcggggccggggtcccacgctgcggagcgcggtcgcggtgcaggggaggggagcg
gcggcggtggccgcgagaggggtgaggtgggaggccgggaggaggaaggggaaggggagg
atggtcggggtcaggtgcgaggccgccgtcaccgagaagcccgccggggaggaggaggcg
gccggcgagcagttcgagtaccaggctgaggtcagccgattgctggatttgattgtccac
agcctgtatagccacaaggaggtttttctccgtgaactcgtaagtaatgcaagtgacgcg
ctggataagctgagatttctcagtgtaactgattcctctgtattgtccgatggcggtgag
ttggaaattaggatcaaacccgacccagaggctggcacaattactatcactgatactggc
attgggatgaccaaagatgaactcaaagattgccttggaaccatcgcccaaagtggcacc
tccaaatttttgaaggctcttaaggagaacaaagatcttggtgcagataatggacttatt
ggtcaatttggtgtgggattttattcggcttttcttgttgcagagaaggttgtggtttcc
actaagagtccaaaggcagacaaacagtatgtatgggaagctatggctgacagcagctca
tatgttattaaggaagaaaccgatcctgagaaaatgttgacacgcggaacacagattact
ctgtttttaagagatgatgataagtacgagtttgctgaccctggacgtattcaaggttta
gttaagaactattcccagtttgtttcattccccatatatacatggcaggagaaatcaaga
acagttgaggttgaagaagaagaaccgaaagaaggtgaagaggcaacagagggtgaaaag
aagaagaaaaagaaaacaatcactgagaagtactgggattgggaattggctaatgaaaca
aagcccatatggatgagaaatccaaaggaagttgagaaaactgagtacaatgaattctac
aagaaggcattcaatgagtttttggatcctcttgcttacacccactttacaacagagggt
gaggtggaattcaggagcgtcctctacattccaggaatggcacctcttagcaatgaggag
ataatgaaccctaagaccaagaatatccggctgtatgttaagagagtcttcatatcagat
gacttcgatggcgagttgttccctagatacttaagctttgtaaagggtgtagtggactca
aatgatcttcctctcaatgtttcccgtgagattcttcaagaaagtcgtattgtcaggatc
atgcgcaaaagacttgtcaggaagacatttgatatgattcaggagattgctgagaaagag
gacaaggaggactacaaaaaattttgggagagttttggcaaatttgttaaacttggctgc
attgaggacacaggaaatcacaaacgccttgctcctctgttgcggttttactcttccaaa
aatgagacagatttgataagtcttgatcagtatgtagagaacatgccagaaaaccaaaag
gcaatctactacattgctacagacagtcttcagagtgcaaagactgctcctttcttggaa
aagttggttcaaaaagacattgaagttctctaccttatcgagccgattgatgaggttgcc
attcagaatttacagacatacaaagagaaaaaatttgttgatatcagcaaagaagacctg
gaattgggtgatgaagatgaggacaaggaaaatgagagcaagcaggaatacactcttcta
tgtgactggataaagcaacagcttggtgacaaagttgccaaggttcagatatcaaaccgg
cttagctcttcgccatgtgttcttgtatctggcaaatttggttggtcagcaaacatggaa
aggcttatgaaggcacaaacacttggtgatacttcaagcttagagttcatgagaggaaga
agaatttttgaaatcaaccccgaccacccaattgtcaaggacttgagtgctgcttgcaaa
aacgagcctgaaagtaccgaagccaagagggccgttgagctgttgtacgagactgcgctg
atctccagtggatatactcctgacagcccagctgagttgggtggcaagatctacgagatg
atgaccatcgctcttggcgggagatggggaagaccggaggagtctgaagccgccaccagc
gaatccaacgttgaggtagagtcttctgaaggttccgcgacggaagttgttgagccctct
gaagtgaggcccgagagtgatccatggaaggattaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4347402
Entry
4347402           CDS       T01015                                 
Name
(RefSeq) heat shock protein 81-2
  KO
K04079  molecular chaperone HtpG
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04141  Protein processing in endoplasmic reticulum
osa04626  Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    4347402
 09150 Organismal Systems
  09159 Environmental adaptation
   04626 Plant-pathogen interaction
    4347402
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:osa01009]
    4347402
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:osa03110]
    4347402
   04131 Membrane trafficking [BR:osa04131]
    4347402
   03051 Proteasome [BR:osa03051]
    4347402
   03029 Mitochondrial biogenesis [BR:osa03029]
    4347402
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4347402
Protein phosphatases and associated proteins [BR:osa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     4347402
Chaperones and folding catalysts [BR:osa03110]
 Heat shock proteins
  HSP90
   4347402
Membrane trafficking [BR:osa04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    4347402
Proteasome [BR:osa03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    4347402
Mitochondrial biogenesis [BR:osa03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-independent mechanism factors
    4347402
Exosome [BR:osa04147]
 Exosomal proteins
  Proteins found in most exosomes
   4347402
SSDB
Motif
Pfam: HSP90 HATPase_c HATPase_c_3
Other DBs
NCBI-GeneID: 4347402
NCBI-ProteinID: XP_015611110
UniProt: Q69QQ6
LinkDB
Position
9:complement(18514694..18518352)
AA seq 699 aa
MASETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDA
QPELFIHIVPDKASNTLSIIDSGVGMTKSDLVNNLGTIARSGTKEFMEALAAGADVSMIG
QFGVGFYSAYLVAERVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGEQLGRGTKITLYLK
DDQLEYLEERRLKDLVKKHSEFISYPISLWTEKTTEKEISDDEDEEEKKDAEEGKVEDVD
EEKEEKEKKKKKIKEVSHEWNVMNKQKPIWLRKPEEITKEEYAAFYKSLTNDWEEHLAVK
HFSVEGQLEFKAILFVPKRAPFDLFDTRKKQNNIKLYVRRVFIMDNCEELIPEWLSFVKG
IVDSEDLPLNISREMLQQNKILKVIRKNLVKKCVELFFEIAENKEDYNKFYEAFSKNLKL
GIHEDSTNRTKIAELLRYHSTKSGDELTSLKDYVTRMKEGQSEIYYITGESKKAVENSPF
LEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKRQEELKEK
FEGLCKVIKEVLGDKVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGY
MSSKKTMEINPENSIMDELRKRADADKNDKSVKDLVMLLFETALLTSGFSLEDPNTFGTR
IHRMLKLGLSIDEDESAEADADMPPLEDDAGESKMEEVD
NT seq 2100 nt   +upstreamnt  +downstreamnt
atggcgtcggagaccgagacgttcgccttccaggccgagatcaaccagctgctgtccctc
atcatcaacaccttctactccaacaaggagatcttcctccgcgagctcatctccaactcc
tccgatgcattggataagattaggttcgagagcctcacggacaagagcaagctcgatgcg
cagccggagctgttcatccacattgtccccgacaaggctagcaacaccctgtcgatcatc
gacagtggtgtcggcatgaccaagtcggacctcgtcaacaacctcggtaccatcgccagg
tcggggaccaaggagttcatggaggcgctcgctgctggtgctgatgtgtccatgattggg
cagtttggtgtcgggttctactccgcctaccttgttgctgagagggttgttgtgaccacc
aagcacaacgacgacgagcagtatgtgtgggagtcacaggccggtgggtccttcactgtt
acacgtgatacctctggtgagcagcttggacggggtactaagatcaccctctacctcaag
gatgatcagctggaataccttgaggaacgtcgcctcaaggatctggtgaagaagcattct
gagttcatcagctaccctatctccttatggactgagaagacaaccgagaaggagatttct
gatgatgaagacgaggaagagaagaaggatgctgaggagggaaaggttgaggatgttgat
gaggagaaggaagagaaagagaagaaaaagaagaagatcaaggaagtctctcatgagtgg
aacgtgatgaacaagcagaaacctatttggttgaggaagccagaggagatcaccaaggaa
gagtatgctgctttctacaagagcttgacaaacgactgggaggaacatctggctgtcaag
cacttctctgtggagggtcagcttgaattcaaggccatcctgtttgtaccaaagagagcg
ccatttgacctctttgacaccaggaagaagcaaaacaacatcaagctgtacgtacgccgg
gtgtttatcatggacaactgtgaggagttgatcccagagtggctcagctttgtcaagggc
attgttgattctgaagaccttcccctcaacatctcacgtgagatgctccagcagaacaag
atcctgaaggtgatccgcaagaaccttgtgaagaagtgcgtggagctcttctttgagatc
gctgagaacaaggaagactacaacaagttctacgaggccttctccaagaatctcaagctt
ggcatccatgaggactccaccaacaggaccaagattgctgagctcctgaggtatcactcc
accaagagtggtgatgagttgaccagcctcaaggactacgtaacccggatgaaggagggc
cagagtgagatctattacatcactggtgagagcaagaaggctgttgagaactcccccttc
cttgagaagctgaagaagaagggatatgaggtcctgtacatggttgatgccattgatgag
tacgctgttggtcagcttaaggagtttgagggcaagaagctcgtctctgccaccaaggaa
ggtctgaagcttgatgagagtgaggacgagaagaagcggcaggaggaactcaaggagaag
ttcgagggtctgtgcaaggtgatcaaggaggtgctcggtgacaaggtggagaaggttgtt
gtctctgaccgtgtggtggactctccctgctgtctagtcactggggagtatggctggact
gctaacatggagaggatcatgaaggcccaggctctgagggactccagcatggccggctac
atgtcgagcaagaagaccatggagatcaacccggagaattccatcatggacgagctccgc
aagcgtgccgatgctgacaagaacgacaagtctgtgaaggacctggtgatgctgctcttc
gagactgccctcctgacctccggcttcagccttgaggaccccaacaccttcggcaccagg
atccaccggatgctcaagctcggcctgagcatcgacgaggacgagtctgctgaggctgac
gccgacatgccgccgctggaggacgacgccggcgagagcaagatggaggaggtcgactaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4347405
Entry
4347405           CDS       T01015                                 
Name
(RefSeq) heat shock protein 81-3 isoform X1
  KO
K04079  molecular chaperone HtpG
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04141  Protein processing in endoplasmic reticulum
osa04626  Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    4347405
 09150 Organismal Systems
  09159 Environmental adaptation
   04626 Plant-pathogen interaction
    4347405
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:osa01009]
    4347405
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:osa03110]
    4347405
   04131 Membrane trafficking [BR:osa04131]
    4347405
   03051 Proteasome [BR:osa03051]
    4347405
   03029 Mitochondrial biogenesis [BR:osa03029]
    4347405
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4347405
Protein phosphatases and associated proteins [BR:osa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     4347405
Chaperones and folding catalysts [BR:osa03110]
 Heat shock proteins
  HSP90
   4347405
Membrane trafficking [BR:osa04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    4347405
Proteasome [BR:osa03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    4347405
Mitochondrial biogenesis [BR:osa03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-independent mechanism factors
    4347405
Exosome [BR:osa04147]
 Exosomal proteins
  Proteins found in most exosomes
   4347405
SSDB
Motif
Pfam: HSP90 HATPase_c HATPase_c_3
Other DBs
NCBI-GeneID: 4347405
NCBI-ProteinID: XP_015611111
UniProt: Q07078 B7E719 Q0J0U8
Structure
LinkDB
Position
9:complement(18525551..18529811)
AA seq 699 aa
MASETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDA
QPELFIHIVPDKASNTLSIIDSGVGMTKSDLVNNLGTIARSGTKEFMEALAAGADVSMIG
QFGVGFYSAYLVAERVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGEQLGRGTKITLYLK
DDQLEYLEERRLKDLVKKHSEFISYPISLWTEKTTEKEISDDEDEEEKKDAEEGKVEDVD
EEKEEKEKKKKKIKEVSHEWNVMNKQKPIWLRKPEEITKEEYAAFYKSLTNDWEEHLAVK
HFSVEGQLEFKAILFVPKRAPFDLFDTRKKQNNIKLYVRRVFIMDNCEELIPEWLSFVKG
IVDSEDLPLNISREMLQQNKILKVIRKNLVKKCVELFFEIAENKEDYNKFYEAFSKNLKL
GIHEDSTNRTKIAELLRYHSTKSGDELTSLKDYVTRMKEGQSEIYYITGESKKAVENSPF
LEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKRQEELKEK
FEGLCKVIKEVLGDKVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGY
MSSKKTMEINPENAIMDELRKRADADKNDKSVKDLVMLLFETALLTSGFSLEDPNTFGTR
IHRMLKLGLSIDEDESAEADADMPPLEDDAGESKMEEVD
NT seq 2100 nt   +upstreamnt  +downstreamnt
atggcgtcggagaccgagacgttcgccttccaggccgagatcaaccagctgctgtccctc
atcatcaacaccttctactccaacaaggagatcttcctccgcgagctcatctccaactcc
tccgatgcattggataagattaggttcgagagcctcacggacaagagcaagctcgatgcg
cagccggagctgttcatccacattgtccccgacaaggctagcaacaccctgtcgatcatc
gacagtggtgtcggcatgaccaagtcggacctcgtcaacaacctcggtaccatcgccagg
tcggggaccaaggagttcatggaggcgctcgctgctggtgctgatgtgtccatgattggg
cagtttggtgtcgggttctactccgcctaccttgttgctgagagggttgttgtgaccacc
aagcacaacgacgacgagcagtatgtgtgggagtcacaggccggtgggtccttcactgtt
acacgtgatacctctggtgagcagcttggacggggtactaagatcaccctctacctcaag
gatgatcagctggaataccttgaggagcgtcgcctcaaggatctggtgaagaagcattct
gagttcatcagctaccctatctccctatggactgagaagacaactgagaaggagatttct
gatgatgaagacgaggaagagaagaaggatgctgaggagggaaaggttgaggatgttgat
gaggagaaggaagagaaagagaagaaaaagaagaagatcaaggaagtctctcacgagtgg
aacgtgatgaacaagcagaaacccatttggttgaggaagccagaggagatcaccaaggaa
gagtacgctgctttctacaagagcttgacaaacgactgggaggaacatctggctgtcaag
cacttctctgtggagggtcagcttgaattcaaggccatcctgtttgtaccaaagagagcg
ccatttgacctctttgacaccaggaagaagcaaaacaacatcaagctgtacgtacgccgg
gtgtttatcatggacaactgtgaggagttgatcccagagtggctcagctttgtcaagggc
attgttgattctgaagaccttcccctcaacatctcacgtgagatgctccagcagaacaag
atcctgaaggtgatccgcaagaaccttgtgaagaagtgcgtggagctcttctttgagatc
gctgagaacaaggaagactacaacaagttctacgaggctttctccaagaatctcaagctt
ggcatccatgaggattccaccaacaggaccaagattgctgagctcctgaggtatcactcc
accaagagtggtgatgagttgaccagcctcaaggactacgtaacccggatgaaggagggc
cagagtgagatctattacatcactggtgagagcaagaaggctgttgagaactcccccttc
ctcgagaagctgaagaagaagggttatgaggtcctgtacatggttgatgccattgatgag
tacgctgttggtcagcttaaggagtttgaaggcaagaagctcgtctctgccaccaaggaa
ggtctgaagcttgatgagagtgaggacgagaagaagcggcaggaggaactcaaggagaag
ttcgagggtctgtgcaaggtgatcaaggaggtgctcggtgacaaggtggagaaggttgtt
gtctctgaccgtgtggtggactctccctgctgtctagtcactggggagtatggctggact
gctaacatggagaggatcatgaaggcccaggctctgagggactccagcatggccggctac
atgtctagcaagaagaccatggagatcaacccggagaatgccatcatggacgagctccgc
aagcgtgccgatgcggacaagaatgacaagtccgtgaaggacctggtgatgctgctcttc
gagactgccctgctgacctccggtttcagcttggaggaccccaacaccttcggcaccagg
atccaccgcatgctcaagctcggcctgagcatcgacgaggacgagtccgccgaggctgac
gccgacatgccgccgctggaggacgacgccggcgagagcaagatggaggaggtcgactaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4352339
Entry
4352339           CDS       T01015                                 
Name
(RefSeq) heat shock protein 90-6, mitochondrial
  KO
K09487  heat shock protein 90kDa beta
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04141  Protein processing in endoplasmic reticulum
osa04626  Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    4352339
 09150 Organismal Systems
  09159 Environmental adaptation
   04626 Plant-pathogen interaction
    4352339
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:osa03110]
    4352339
Chaperones and folding catalysts [BR:osa03110]
 Heat shock proteins
  HSP90
   4352339
SSDB
Motif
Pfam: HSP90 HATPase_c HATPase_c_3
Other DBs
NCBI-GeneID: 4352339
NCBI-ProteinID: XP_015620006
UniProt: Q0IN14 A0A0P0YAS2
LinkDB
Position
12:complement(19921576..19927761)
AA seq 811 aa
MLGASRRSVCTAAAAAAAGSRRRAAAGVASAVSGDSSVSSSSAPPRSVINGEPGVPQLQK
RLLSVLAAPKLTGTDNAASLKLREGSLVGRRYESSAAAVDSSDTPPVEKHEYQAEVNRLM
DLIVHSLYSNKEVFLRELVSNASDALDKLRYLSVTDPDLIKDGAGLDIRIQTDKENGIIT
ITDTGIGMTRQELVDSLGTIASSGTAKFLKALKESQEAGVDSNLIGQFGVGFYSAFLVSD
KVAVSTKSPKSDKQYVWEGEAESSSYTIREETDPEKLLPRGTRLTLYLKREDKGFAHPEK
IQKLVKNYSQFVSFPIYTWQEKGYTKEVEVDEPVEAKEGDDETKTEVKKKTKTVVEKYWD
WELTNETQPIWLRNPREVSTEEYNEFYKKTFNEYMDPLASSHFTTEGEVEFRSILYVPAT
KKEDITDRKTKNIRLYVKRVFISDDFDGELFPRYLSFVRGVVDSNDLPLNVSREILQESR
IVRIMRKRLVRKAFDMILGISCSENRDDYERFWENYGKFLKLGCMEDKENHKRIAPLLRF
FSSQSNEELISLDEYVENMKPEQKDIYYIAADSLSSAKHAPFLEKLNEKEYEVLFLVDPM
DEVSVTNLNSYKDKRFVDISKEDLDLGDKNEEKEKEIKQEYSQTCDWIKKRLGEKVARVD
ISNRLSSSPCVLVAAKFGWSANMERLMRAQSMGDMSSLDFMRSRKVFEINPEHEIIKGLN
AACRANPDDPEALKAVDILFETSMISSGFTPDNPAELSGKIYEMMSTAMASKWASHAQPA
EMNLQRDSPVSSEPIEAEVIEPELVDDSQKK
NT seq 2436 nt   +upstreamnt  +downstreamnt
atgctcggggcctcgaggcgttccgtctgcaccgccgcggcggcggcggcggccgggtca
cgccgccgcgccgccgccggcgtcgcctccgccgtttccggggattcctccgtctcgtct
tcctcggcgcccccacgctcggtgattaatggggagcctggtgtccctcagcttcagaag
aggttgctctctgtgcttgctgcgcccaagcttaccgggaccgacaatgctgcctccctc
aagctgagggagggttcccttgttggcaggcgatatgaatcgagtgctgcagcagttgat
tcttctgatacgccacctgtggagaagcatgagtaccaggcagaggtcaataggctcatg
gacttgattgttcacagcttgtatagcaacaaggaggtgtttcttcgagagcttgtcagc
aatgcaagtgatgcacttgataagttgcggtatcttagtgtcactgatcctgatcttata
aaggatggtgctggtcttgacattcgcatccaaacagataaggagaatggaataataaca
atcactgatactgggattggtatgacgaggcaagaacttgttgattctcttggaactata
gcgagcagtggaactgccaaattccttaaggcactaaaggagagccaagaggctggtgtt
gacagcaacttgattggtcaatttggtgttggattctattctgcgtttcttgtttctgat
aaggttgcagtgtcaactaagagcccaaaatctgacaagcaatatgtttgggaaggcgag
gcagaatctagttcttacaccattagagaggagacagacccagagaagctccttcctagg
ggaactcgccttactctgtaccttaagcgtgaggacaagggtttcgcacaccctgagaag
attcagaaacttgtgaagaattactcacagtttgtttccttccctatttatacttggcaa
gagaaaggttacacaaaagaggttgaggtcgatgaacctgttgaagctaaagaaggcgac
gatgagactaaaacagaggttaagaaaaagacaaaaacagttgttgagaagtactgggat
tgggagcttacaaatgaaacacaacctatatggcttcggaaccctagagaggtatcaact
gaggagtacaatgagttttacaagaagacattcaatgagtacatggatcccttagcatcc
tcacactttactacagagggggaagtagaattcagatctattctctatgtgcctgctaca
aagaaggaggatataactgataggaagaccaaaaatatcaggctttatgttaagcgcgtg
tttatatcagacgactttgatggggaactgttcccaagatacctgagctttgtgaggggt
gttgttgactcaaatgaccttccattaaatgtttctcgtgagatcctgcaagaaagccga
attgtgcgtataatgagaaagaggttggtgcgaaaggcctttgatatgatacttggcatc
tcttgtagcgaaaacagagatgactatgaaaggttctgggaaaactatggcaagttctta
aagctgggttgcatggaagacaaggaaaatcacaagagaattgctcctttgctccgattc
ttttcttctcaaagcaatgaagaattaattagcttggatgaatacgtggaaaatatgaaa
cctgagcaaaaggacatttactacattgctgcggacagtttgagtagtgcaaaacatgct
cctttcctggagaagctcaatgaaaaagagtacgaggttctatttttagttgacccaatg
gatgaagtgtctgtcacaaatctgaactcctacaaggataagcgtttcgttgatattagc
aaggaagacttggacttaggtgataagaatgaggaaaaagagaaggagatcaagcaggaa
tacagccaaacatgtgactggatcaagaaacgcttgggtgaaaaggttgctcgagttgat
atatcaaaccgtctcagctcatcaccatgtgttctagttgcagctaagtttggttggtct
gcgaacatggaaaggttgatgagagcgcaatctatgggtgacatgtcatctctggatttc
atgcgttctaggaaagtttttgaaatcaacccagagcatgagatcatcaagggcttgaat
gctgcctgcagagccaaccctgatgacccagaagctctaaaggctgtagatatcctgttt
gaaacttctatgatctctagtggctttacacctgacaaccctgccgagctaagtgggaag
atatatgagatgatgagcacagctatggccagcaagtgggcctcgcacgctcaacccgct
gagatgaacctgcagcgagactcacctgtcagctctgagccgattgaagccgaggtgatt
gagccggagttggtggacgatagccagaagaaataa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9267802
Entry
9267802           CDS       T01015                                 
Name
(RefSeq) heat shock protein 81-3
  KO
K04079  molecular chaperone HtpG
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04141  Protein processing in endoplasmic reticulum
osa04626  Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    9267802
 09150 Organismal Systems
  09159 Environmental adaptation
   04626 Plant-pathogen interaction
    9267802
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:osa01009]
    9267802
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:osa03110]
    9267802
   04131 Membrane trafficking [BR:osa04131]
    9267802
   03051 Proteasome [BR:osa03051]
    9267802
   03029 Mitochondrial biogenesis [BR:osa03029]
    9267802
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    9267802
Protein phosphatases and associated proteins [BR:osa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     9267802
Chaperones and folding catalysts [BR:osa03110]
 Heat shock proteins
  HSP90
   9267802
Membrane trafficking [BR:osa04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    9267802
Proteasome [BR:osa03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    9267802
Mitochondrial biogenesis [BR:osa03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-independent mechanism factors
    9267802
Exosome [BR:osa04147]
 Exosomal proteins
  Proteins found in most exosomes
   9267802
SSDB
Motif
Pfam: HSP90 HATPase_c HATPase_c_3
Other DBs
NCBI-GeneID: 9267802
NCBI-ProteinID: XP_015611113
UniProt: Q07078 B7E719 Q0J0U8
Structure
LinkDB
Position
9:complement(18537010..18541207)
AA seq 699 aa
MASETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDA
QPELFIHIVPDKASNTLSIIDSGVGMTKSDLVNNLGTIARSGTKEFMEALAAGADVSMIG
QFGVGFYSAYLVAERVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGEQLGRGTKITLYLK
DDQLEYLEERRLKDLVKKHSEFISYPISLWTEKTTEKEISDDEDEEEKKDAEEGKVEDVD
EEKEEKEKKKKKIKEVSHEWNVMNKQKPIWLRKPEEITKEEYAAFYKSLTNDWEEHLAVK
HFSVEGQLEFKAILFVPKRAPFDLFDTRKKQNNIKLYVRRVFIMDNCEELIPEWLSFVKG
IVDSEDLPLNISREMLQQNKILKVIRKNLVKKCVELFFEIAENKEDYNKFYEAFSKNLKL
GIHEDSTNRTKIAELLRYHSTKSGDELTSLKDYVTRMKEGQSEIYYITGESKKAVENSPF
LEKLKKKGYEVLYMVDAIDEYAVGQLKEFEGKKLVSATKEGLKLDESEDEKKRQEELKEK
FEGLCKVIKEVLGDKVEKVVVSDRVVDSPCCLVTGEYGWTANMERIMKAQALRDSSMAGY
MSSKKTMEINPENAIMDELRKRADADKNDKSVKDLVMLLFETALLTSGFSLEDPNTFGTR
IHRMLKLGLSIDEDESAEADADMPPLEDDAGESKMEEVD
NT seq 2100 nt   +upstreamnt  +downstreamnt
atggcgtcggagaccgagacgttcgccttccaggccgagatcaaccagctgctgtccctc
atcatcaacaccttctactccaacaaggagatcttcctccgcgagctcatctccaactcc
tccgatgcattggataagattaggttcgagagcctcacggacaagagcaagctcgatgcg
cagccggagctgttcatccacattgtccccgacaaggctagcaacaccctgtcgatcatc
gacagtggtgtcggcatgaccaagtcggacctcgtcaacaacctcggtaccatcgccagg
tcggggaccaaggagttcatggaggcgctcgctgctggtgctgatgtgtccatgattggg
cagtttggtgtcgggttctactccgcctaccttgttgctgagagggttgttgtgaccacc
aagcacaacgacgacgagcagtatgtgtgggagtcacaggccggtgggtccttcactgtt
acacgtgatacctctggtgagcagcttggacggggtactaagatcaccctctacctcaag
gatgatcagctggaataccttgaggagcgtcgcctcaaggatctggtgaagaagcattct
gagttcatcagctaccctatctccctatggactgagaagacaactgagaaggagatttct
gatgatgaagacgaggaagagaagaaggatgctgaggagggaaaggttgaggatgttgat
gaggagaaggaagagaaagagaagaaaaagaagaagatcaaggaagtctctcacgagtgg
aacgtgatgaacaagcagaaacccatttggttgaggaagccagaggagatcaccaaggaa
gagtacgctgctttctacaagagcttgacaaacgactgggaggaacatctggctgtcaag
cacttctctgtggagggtcagcttgaattcaaggccatcctgtttgtaccaaagagagcg
ccatttgacctctttgacaccaggaagaagcaaaacaacatcaagctgtacgtacgccgg
gtgtttatcatggacaactgtgaggagttgatcccagagtggctcagctttgtcaagggc
attgttgattctgaagaccttcccctcaacatctcacgtgagatgctccagcagaacaag
atcctgaaggtgatccgcaagaaccttgtgaagaagtgcgtggagctcttctttgagatc
gctgagaacaaggaagactacaacaagttctacgaggctttctccaagaatctcaagctt
ggcatccatgaggattccaccaacaggaccaagattgctgagctcctgaggtatcactcc
accaagagtggtgatgagttgaccagcctcaaggactacgtaacccggatgaaggagggc
cagagtgagatctattacatcactggtgagagcaagaaggctgttgagaactcccccttc
ctcgagaagctgaagaagaagggttatgaggtcctgtacatggttgatgccattgatgag
tacgctgttggtcagcttaaggagtttgaaggcaagaagctcgtctctgccaccaaggaa
ggtctgaagcttgatgagagtgaggacgagaagaagcggcaggaggaactcaaggagaag
ttcgagggtctgtgcaaggtgatcaaggaggtgctcggtgacaaggtggagaaggttgtt
gtctctgaccgtgtggtggactctccctgctgtctagtcactggggagtatggctggact
gctaacatggagaggatcatgaaggcccaggctctgagggactccagcatggccggctac
atgtctagcaagaagaccatggagatcaacccggagaatgccatcatggacgagctccgc
aagcgtgccgatgcggacaagaatgacaagtccgtgaaggacctggtgatgctgctcttc
gagactgccctgctgacctccggtttcagcttggaggaccccaacaccttcggcaccagg
atccaccgcatgctcaagctcggcctgagcatcgacgaggacgagtccgccgaggctgac
gccgacatgccgccgctggaggacgacgccggcgagagcaagatggaggaggtcgactaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9267997
Entry
9267997           CDS       T01015                                 
Name
(RefSeq) heat shock protein 82
  KO
K04079  molecular chaperone HtpG
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04141  Protein processing in endoplasmic reticulum
osa04626  Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    9267997
 09150 Organismal Systems
  09159 Environmental adaptation
   04626 Plant-pathogen interaction
    9267997
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:osa01009]
    9267997
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:osa03110]
    9267997
   04131 Membrane trafficking [BR:osa04131]
    9267997
   03051 Proteasome [BR:osa03051]
    9267997
   03029 Mitochondrial biogenesis [BR:osa03029]
    9267997
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    9267997
Protein phosphatases and associated proteins [BR:osa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     9267997
Chaperones and folding catalysts [BR:osa03110]
 Heat shock proteins
  HSP90
   9267997
Membrane trafficking [BR:osa04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    9267997
Proteasome [BR:osa03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    9267997
Mitochondrial biogenesis [BR:osa03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-independent mechanism factors
    9267997
Exosome [BR:osa04147]
 Exosomal proteins
  Proteins found in most exosomes
   9267997
SSDB
Motif
Pfam: HSP90 HATPase_c HATPase_c_3 LOH1CR12
Other DBs
NCBI-GeneID: 9267997
NCBI-ProteinID: XP_015634277
UniProt: Q7XR98
LinkDB
Position
4:483216..486030
AA seq 703 aa
MAAAGDVQMAEKETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLT
DKSKLDAQPELFIRLVPYKPSKTLSIIDSGVGMTKSDLVNNLGTIARSGTKEFMEALQAG
ADVSMIGQFGVGFYSAYLVAEKVVVTTKHNDDEQYVWESQAGGSFTVTLDTAGERLGRGT
KITLFLKDDQLEYLEERRLKDLVKKHSEFISYPIYLWSEKTTEKEISDDEDDDIDDSKGK
EKEGDIEEVKDKKKKKKVNEVSHEWVQINKQKPIWLRKPEEISREEYASFYKSLTNDWED
HLAVKHFSVEGQLEFKAILFVPRRAPFDLFDTRKKMNNIKLYVRRVFIMDNCEELIPEWL
GFVKGVVDSDDLPLNISREMLQQNKILKVIRKNLVKKCIEMFFEIADNKEDYAKFYEAFS
KNLKLGIHEDSQNRGKLADLLRYHSTKSGNELTSLKDYVTRMKEGQKEVYYITGESRKAV
ENSPFLEKLKKKGYEVLFMVDAIDEYAVGQLKEYDGKKLVSATKEGLKLDDDDDAKERKR
SFEPLCKVIKDILGDRVEKVVVSDRIVDSPCCLVTGEYGWTANMERIMKAQALRDSSMGA
YMSSKKTMEINPENGIMEELRKRADADANDKSVRDLVLLLFETALLTSGFSLDDPNTFAA
RIHRMLKLGLNIDDDDAAAADDDADMPALDDAAAEESKMEEVD
NT seq 2112 nt   +upstreamnt  +downstreamnt
atggcggcggcgggggacgtgcagatggcggagaaggagacgttcgcgttccaggcagag
atcaaccagctgctctccctcatcatcaacaccttctactccaacaaggagatcttcctc
cgcgagctcatctccaactcttctgatgcgcttgacaagatccgcttcgagagcctcacc
gacaagagcaagctggacgcccagccggagctcttcatccgcctcgtcccctacaagccc
tccaagactctctccatcatcgacagcggcgtcggcatgaccaagtccgacctcgtgaac
aatttgggcaccatcgcgcgctccggcaccaaggagttcatggaggcgctgcaggcgggc
gccgacgtgagcatgatcgggcagttcggcgtcggcttctactccgcctacctcgtcgcc
gagaaggtggtggtcaccaccaagcacaacgacgacgagcagtacgtgtgggagtcgcag
gccggcggctccttcaccgtcaccctcgacaccgccggcgagcgcctcggccgcggcacc
aagatcaccctcttcctcaaggacgaccagctcgagtacctggaggagcgccgcctcaag
gacctcgtcaagaagcactccgagttcatcagctaccccatctacctctggtccgagaag
accaccgagaaggagatcagcgacgacgaggacgacgacattgacgactccaaaggcaag
gagaaggaaggcgacatcgaggaggtcaaagataagaagaagaagaagaaggtgaacgag
gtgagccatgaatgggtgcagatcaacaagcagaagcccatctggctgcggaagccggag
gagatcagccgggaggagtacgcgtccttctacaagagcctcaccaacgactgggaggac
cacctcgccgtgaagcacttctccgtggaggggcagctggagttcaaggccatcctcttc
gtgccccgccgcgcgcccttcgacctgttcgacacccgcaagaagatgaacaacatcaag
ctctacgtgcgccgcgtcttcatcatggacaactgcgaggagctcatcccggagtggctc
ggcttcgtcaagggcgtcgtcgactccgacgacctcccgctcaacatctcccgcgagatg
ctgcagcagaacaagatcctcaaggtcatccgcaagaacctcgtcaagaaatgcatcgag
atgttcttcgagatcgccgacaacaaggaggattacgccaagttctacgaggccttctcc
aagaacctcaagctggggatccacgaggactcgcagaaccgcggcaagctcgccgacctg
ctccggtaccactccaccaagtccggcaacgagctcaccagcctcaaggactatgtgacc
cggatgaaggaagggcagaaggaggtctactacatcaccggcgagagccgcaaggccgtg
gagaactcgccgttcctggagaagctgaagaagaaggggtacgaggtgctgttcatggtg
gacgccatcgacgagtacgccgtcgggcagctcaaggagtacgacggcaagaagctggtg
tccgccaccaaggaagggctcaagctggacgacgacgacgacgccaaggagaggaagagg
tcgttcgagccgctctgcaaggtgatcaaggacattctgggcgatcgcgtggagaaggtg
gtggtctcggaccggatcgtggactcgccgtgctgcctggtcaccggcgagtacggctgg
acggcgaacatggagcggatcatgaaggcgcaggcgctgcgggacagcagcatgggcgcg
tacatgtcgagcaagaagacgatggagatcaacccggagaacgggatcatggaggagctc
cggaagcgcgccgacgctgacgccaacgacaagtccgtcagggacctcgtcctcctcctc
ttcgagacggcgctgctcacctccggcttcagcctcgacgacccaaacaccttcgccgcc
aggatccaccgcatgctcaagctcggcctcaacatcgacgacgacgacgccgccgcggcc
gacgacgacgctgacatgcccgcgctcgatgacgccgccgccgaggagagcaagatggag
gaggtggactga

DBGET integrated database retrieval system