KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4342171
Entry
4342171           CDS       T01015                                 
Name
(RefSeq) methylsterol monooxygenase 2-1
  KO
K14424  plant 4alpha-monomethylsterol monooxygenase [EC:1.14.18.11]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00100  Steroid biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00917  Phytosterol biosynthesis, squalene 2,3-epoxide => campesterol/sitosterol
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    4342171
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.18  With another compound as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.18.11  plant 4alpha-monomethylsterol monooxygenase
     4342171
SSDB
Motif
Pfam: FA_hydroxylase
Other DBs
NCBI-GeneID: 4342171
NCBI-ProteinID: XP_015646592
UniProt: Q69L93
LinkDB
Position
7:88338..90882
AA seq 268 aa
MMAAAGLESAWEYLITHFSEFQLASIGTFLLHESVFFLSGLPSLLFERLGLFSKYKIQKK
SNTPDYQNRCVVRLVLYHVCVNLPLTILSYRTFKFMGLRSTLPLPHWTVVVSQVLFFFVL
EDFIFYWGHRALHTKWLYQHVHSVHHEYATPFGLTSEYAHPAEILFLGFATVAGPALTGP
HLFTLWVWMVLRVLETVEAHSGYHFPWSPSNFLPLYGGAEFHDYHHRVLYTKSGNYSSTF
IYMDWLFGTDKDYRKTKALEEKERTKHL
NT seq 807 nt   +upstreamnt  +downstreamnt
atgatggcggcggcggggctggagtcggcgtgggagtacctcatcacgcatttcagcgag
ttccagctggcctccatcggcaccttcctcctccacgagagcgtcttcttcctctccggc
ctcccctctctcctcttcgagcgcctcggcctcttctccaagtacaagatccagaagaag
agcaatacacccgattaccagaacagatgtgtagtgcgtctcgttctctaccatgtctgc
gtcaatctccctctcaccattttatcatatcgcaccttcaaattcatgggcttgaggagc
acccttccgctgcctcactggacagttgtcgtctcccaagtgctcttcttttttgtgctt
gaggatttcatattctactgggggcatagggcactgcataccaaatggctgtaccagcat
gttcacagcgtccaccatgaatatgccacaccctttggcctaacatctgaatatgctcac
cctgctgagattctattcttgggctttgctaccgtggccggccctgcccttactggccct
cacctcttcactctctgggtgtggatggtcttgagggtcttggagacagttgaggctcac
agtggctaccacttcccatggagcccgtccaatttcttgccattgtatggcggcgctgaa
ttccatgactatcatcaccgtgttctctacaccaagtctgggaattactcgtcgaccttc
atctacatggactggctgtttgggactgataaagattaccgcaagacaaaggccctagag
gagaaagaaaggacgaagcatctgtaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4351226
Entry
4351226           CDS       T01015                                 
Name
(RefSeq) methylsterol monooxygenase 2-2
  KO
K14424  plant 4alpha-monomethylsterol monooxygenase [EC:1.14.18.11]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00100  Steroid biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00917  Phytosterol biosynthesis, squalene 2,3-epoxide => campesterol/sitosterol
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    4351226
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.18  With another compound as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.18.11  plant 4alpha-monomethylsterol monooxygenase
     4351226
SSDB
Motif
Pfam: FA_hydroxylase
Other DBs
NCBI-GeneID: 4351226
NCBI-ProteinID: XP_015616390
LinkDB
Position
11:complement(28953918..28958011)
AA seq 333 aa
MEVDVQPRKTRQAKQSTRGARARRTRRTARIIHSFSPPPFLTPPLTFIPFSLLPPSPAPL
LPSPASPMAASALDSAWEGLTGSFTEFQLATVVTFLLHETVFFLSGLPSLLFERFGLFAK
YKIQKKSNTPSYQNRCVLRLILYHVCVNLPVMVLSYPAFKFMGLRSSLPLPHWTVIVSQV
LFYFVLEDFIFYWGHRALHTKWLYKHVHSVHHEYATPFGLTSEYAHPAEILFLGFATIVG
PALTGPHLFTLWLWMVLRVLETVEAHSGYHFPWSPSNFLPLYGGSDFHDYHHRVLYTKSG
NYASTFVYMDWLFGTDKDYRNAKAIEEKDGKHL
NT seq 1002 nt   +upstreamnt  +downstreamnt
atggaggtggacgtgcagccacgcaagacaagacaagcaaagcaaagcacgagaggagcg
agggcgaggaggacacgacgcaccgcacggatcattcattcattctctcctcctccgttc
ctgactccaccactcacattcattcccttctctctcctccctccctcccccgcccctctg
ctcccctcgccggcgagcccaatggcggcgtccgccctcgactccgcctgggagggcctc
accggcagcttcaccgagttccagctcgccaccgtcgtcaccttcctcctccacgagacc
gtcttcttcctctccggcctcccctccctcctcttcgagcgcttcggcctcttcgccaag
tacaagatccagaagaagagcaataccccttcttaccagaatagatgtgtgctgcgtctc
attctgtaccatgtctgtgtgaacttgcctgtaatggttttatcctaccctgccttcaaa
ttcatgggcctgaggagctctcttcctctgccacactggacggttattgtttctcaagtt
cttttttactttgtactcgaggattttatattttattggggacatagggcactgcacacc
aaatggctatacaagcatgttcacagcgttcaccatgaatatgctacaccctttggcttg
acttcagaatatgcccaccctgctgaaattttgttccttgggttcgccacaattgttggt
ccggccctcactggtccgcacttgttcactctatggctgtggatggtgttgagggtattg
gagacagttgaagctcacagtggataccatttcccatggagcccatcaaatttcttgcca
ctgtatggaggctccgactttcatgactatcatcaccgtgtgctctacaccaaatcagga
aactacgcctctacttttgtttacatggactggctgtttggcacggacaaggattaccgc
aatgccaaggctatcgaggagaaagacgggaagcatttgtaa

DBGET integrated database retrieval system