KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4342210
Entry
4342210           CDS       T01015                                 
Name
(RefSeq) glutamate--glyoxylate aminotransferase 2
  KO
K14272  glutamate--glyoxylate aminotransferase [EC:2.6.1.4 2.6.1.2 2.6.1.44]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00220  Arginine biosynthesis
osa00250  Alanine, aspartate and glutamate metabolism
osa00260  Glycine, serine and threonine metabolism
osa00630  Glyoxylate and dicarboxylate metabolism
osa00710  Carbon fixation in photosynthetic organisms
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
osa01210  2-Oxocarboxylic acid metabolism
osa01230  Biosynthesis of amino acids
Module
osa_M00171  C4-dicarboxylic acid cycle, NAD - malic enzyme type
osa_M00532  Photorespiration
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    4342210
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    4342210
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    4342210
   00260 Glycine, serine and threonine metabolism
    4342210
   00220 Arginine biosynthesis
    4342210
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:osa01007]
    4342210
Enzymes [BR:osa01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     4342210
    2.6.1.4  glycine transaminase
     4342210
    2.6.1.44  alanine---glyoxylate transaminase
     4342210
Amino acid related enzymes [BR:osa01007]
 Aminotransferase (transaminase)
  Class I
   4342210
SSDB
Motif
Pfam: Aminotran_1_2
Other DBs
NCBI-GeneID: 4342210
NCBI-ProteinID: XP_015646972
UniProt: Q69UU3 A3BFU9
LinkDB
Position
7:complement(446223..451438)
AA seq 485 aa
MFGGGGGGGRKPLDYEELNENVKKVQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQ
KPLTFPRQVVALCQAPFLLDDPNVGLIFPADAIARAKHYLAMAPGGLGAYSDSRGIPGIR
KEVAEFIERRDGYPSDPELIYLTDGASKGVMQMLNTIIRNERDGILVPVPQYPLYSAAIS
LFGGSLVPYYLEEEANWGLDFVNLRQTVASARSKGITVRAMVIINPGNPTGQCLSEGNIK
ELLKFCFHENLVLLADEVYQQNIYQDERPFISARKVLFDMGPPMSREVQLVSFHTVSKGY
WGECGQRGGYFEMTNLPPKTVDEIYKVASIALSPNVPGQIFMGLMVNPPKPGDISYLKFS
AESKSILESLRRRARLMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPKAIDAAKRAGKAAD
VFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMTSFKKFNDTFMDQYD
GYSRM
NT seq 1458 nt   +upstreamnt  +downstreamnt
atgttcggcggcggcggcggcggcgggaggaagccgctggactacgaggagctgaacgag
aacgtgaagaaggtgcagtacgcggtgcggggggagctgtacctgcgcgcctccgagctc
cagaaggagggcaagaagatcatcttcaccaacgtcggcaacccacacgcgctcggccag
aagccgctcaccttcccccgccaggttgtggcgctgtgccaggcccccttcctgctcgat
gatcccaacgtcggccttatcttccccgccgacgccatcgcgcgggccaagcactacctc
gccatggcacccggtggactaggtgcttacagtgattcccgaggtatccctggtattagg
aaggaagtcgccgagttcatcgagaggcgtgatggttatccaagtgatccagaacttatt
tacctcacagatggtgccagcaaaggtgtgatgcaaatgctgaataccattatcagaaat
gagagagatgggattctggttcctgttccacaatacccgctttattctgctgccatttcc
ctctttggtggttctctcgtgccatactacttagaagaagaggctaactggggacttgac
ttcgtcaatctccgacagactgtggcgtcagcgcggtcaaagggaatcactgttcgagca
atggtgattatcaacccaggaaaccctactggccaatgccttagtgaaggaaacataaag
gaacttctcaaattctgcttccatgagaacttagttctgcttgcagatgaagtctatcaa
cagaacatttatcaagatgagcgcccatttataagtgctagaaaggttctgtttgacatg
ggtcctcctatgagcagggaagttcagctggtttctttccatactgtgtcaaaaggatat
tggggggagtgtggacaacgtggagggtattttgaaatgacaaatcttcctcccaagaca
gtagacgagatctacaaggttgcatcaatcgcactcagtccaaatgttcctgggcagatc
tttatgggtttaatggttaaccctcctaagcctggagatatctcttatctgaagttttct
gctgaaagcaagtctatcctcgagtctttgaggaggagagcacgcctgatgacagatggt
ttcaatagttgccgaaatgttgtctgcaatttcacagaaggagctatgtactctttcccc
caaatacgcttaccaccaaaagctatagatgcagccaaaagggctggcaaagcggccgat
gttttctactgcctcaagcttcttgaagcaactggaatatccactgttccagggtcaggt
ttcggacaaaaagaaggggtgttccacctgaggacgaccatcctgccagctgaggaggac
atgcctgccatcatgaccagcttcaagaagttcaacgacactttcatggatcagtacgat
ggctactccaggatgtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4343916
Entry
4343916           CDS       T01015                                 
Name
(RefSeq) alanine aminotransferase 2
  KO
K00814  alanine transaminase [EC:2.6.1.2]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00220  Arginine biosynthesis
osa00250  Alanine, aspartate and glutamate metabolism
osa00710  Carbon fixation in photosynthetic organisms
osa01100  Metabolic pathways
osa01200  Carbon metabolism
osa01210  2-Oxocarboxylic acid metabolism
osa01230  Biosynthesis of amino acids
Module
osa_M00171  C4-dicarboxylic acid cycle, NAD - malic enzyme type
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    4343916
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    4343916
   00220 Arginine biosynthesis
    4343916
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:osa01007]
    4343916
Enzymes [BR:osa01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     4343916
Amino acid related enzymes [BR:osa01007]
 Aminotransferase (transaminase)
  Class I
   4343916
SSDB
Motif
Pfam: Aminotran_1_2
Other DBs
NCBI-GeneID: 4343916
NCBI-ProteinID: XP_015647911
UniProt: B9FU86
LinkDB
Position
7:complement(25492838..25497439)
AA seq 546 aa
MRRFVADRARRAVTSSAASMRAAATRSAAPSAGAAPSAPSPPPAAAAALAMASAMVRAMS
TAAAGAAPVSLDTINPKVLKCEYAVRGEIVTHAQNLQQELQKNPDSLPFDEILYCNIGNP
QSLGQQPVTFFREVLSLCDHPALLDKSETHALYSSDAIERAWQILDKIPGRATGAYSHSQ
GIKGLRDEIAAGIAARDGFHASGDNIFLTDGASPAVHMMMQLLIRSENDGILCPIPQYPL
YSASIALHGGSLVPYFLDEETGWGLEVDELKKQLEEAQSKGITVRALVVINPGNPTGQVL
AEENQKKIVEFCKNEGLVLLADEVYQENIYVEDKKFHSFKKIARSMGYTDDDLPLVSFQS
VSKGYYGECGKRGGYMEVTGFSADVREQIYKVASVNLCSNVSGQILASLIMNPPKAGDES
YESFMVEKDGILSSLARRAKALEEAFNSLEGITCNKAEGAMYLFPRIYLPQKAIGAAQAA
GTAPDAYYARRLLEATGIVVVPGSGFGQVPGTWHFRCTILPQEDKIPAIISKFKEFHEKF
MDEFRD
NT seq 1641 nt   +upstreamnt  +downstreamnt
atgcgccgcttcgtcgccgaccgggcgcggcgcgcggtgacctcctccgccgcttcgatg
cgcgcggccgccaccagatcagccgcgccgtctgccggggctgccccctcggcgccatcc
ccgccgccggccgcggcggcggcgctggccatggcttccgccatggtgagggccatgtcg
accgcggctgccggcgcggcgccggtgtcactcgacaccatcaaccccaaggtgttgaag
tgtgaatatgctgtccgtggagagattgttacacatgctcagaatttacaacaagaatta
cagaaaaacccagactcacttccttttgacgagatactttattgcaacattggaaatccc
caatctcttggccagcagccagttacatttttcagagaggtcttgtcgttatgtgatcat
ccagctctgctggataaaagtgaaactcatgctctgtacagttcagatgctatagaaaga
gcatggcaaattctagacaagatcccaggaagagcaacaggagcctatagccatagtcag
ggtataaagggtttgcgtgatgaaattgctgctggaattgctgcccgtgatggttttcat
gctagtggagataacatattcctaacagatggagcaagcccagcagtgcacatgatgatg
caattattgataagatctgagaatgatggcattctctgccctattccgcaatacccgctc
tactccgcgtcaattgctctccatggtggttctcttgttccttatttccttgatgaagag
acaggttggggactggaggttgatgagcttaagaaacaattggaggaggctcagtctaag
ggtatcactgttagagcacttgttgttataaatccagggaacccaactgggcaggttctt
gctgaggaaaatcaaaagaaaattgtcgaattctgcaaaaatgaaggacttgttcttctt
gcagatgaggtgtaccaagaaaacatatatgtagaagacaagaaattccattctttcaaa
aagatcgcacgatcaatgggatacacagatgatgatcttcctttagtatcattccaatca
gtttcgaaaggttactacggagaatgtggaaaacgaggaggctatatggaagtaactgga
tttagcgctgatgtaagggaacaaatttacaaggtggcatcagtaaacctgtgttccaac
gtgtctggccaaatactcgctagcctcataatgaacccaccgaaggctggggatgaatcc
tatgaatccttcatggtagagaaagacgggatcctctcctctctggctcgacgtgcaaag
gctttggaagaagccttcaacagcttagaaggcataacatgcaacaaggccgagggtgcg
atgtatctcttccctcgcatctatttgccccagaaggcaattggagctgcccaagcagct
ggtactgccccagatgcgtattatgcccgccgccttcttgaagctactggaattgttgtt
gttcctggttctggatttgggcaggttcctggaacgtggcattttagatgcacaattttg
ccacaggaggacaaaataccagcgatcatatccaagttcaaggagttccacgagaagttc
atggatgaattccgggattaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4347138
Entry
4347138           CDS       T01015                                 
Name
(RefSeq) alanine aminotransferase 2 isoform X1
  KO
K00814  alanine transaminase [EC:2.6.1.2]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00220  Arginine biosynthesis
osa00250  Alanine, aspartate and glutamate metabolism
osa00710  Carbon fixation in photosynthetic organisms
osa01100  Metabolic pathways
osa01200  Carbon metabolism
osa01210  2-Oxocarboxylic acid metabolism
osa01230  Biosynthesis of amino acids
Module
osa_M00171  C4-dicarboxylic acid cycle, NAD - malic enzyme type
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    4347138
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    4347138
   00220 Arginine biosynthesis
    4347138
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:osa01007]
    4347138
Enzymes [BR:osa01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     4347138
Amino acid related enzymes [BR:osa01007]
 Aminotransferase (transaminase)
  Class I
   4347138
SSDB
Motif
Pfam: Aminotran_1_2
Other DBs
NCBI-GeneID: 4347138
NCBI-ProteinID: XP_015610920
LinkDB
Position
9:15930473..15936548
AA seq 493 aa
MSYNHSPSITAETINQKVRIFTYEPCGEIVRHARRLEKEIYENPGSLPFQEIIYCNLGNP
QALGQRPINFFREVLSLCDNPSLIDRDEARALFRLDQIDKHPCALKRARKIIESLPGRDS
GSYTSSQGVRGLREAVADGIAARDGFPSKPDNIFLTDGASSAINMMMQILIRSHEDGILC
PLPEYPLYSASIILHGGTMVPYNLTEDSIWGLEIFEVKRCLEDARASGLTIRAMVVINPG
NPTGQVLSITNQEEIVEFCRKEGLVILADEVYQENVYTENKRFNSFKKVARSLGYDHHDL
SIVSFHSVSMGYYGECGRRGGYMEICGFGDDVIDEMYKLASLTICPNIAGQILISLVMDP
PKLGDEAFEIFMVEKEETYSSLLKRAKALQKAFNGLEGVSCNKFEGAMYLFPRLRLPQAA
IKAAQLEGVSPDVFYAHRLLDATGIAVVPGSGFHPVSGTSHIRCTILPGEETITAMVPSL
QAFHEAFMDEFRG
NT seq 1482 nt   +upstreamnt  +downstreamnt
atgtcgtacaaccattcgccgtccatcaccgcagagaccataaaccagaaggtcaggatc
ttcacctacgagccatgtggggagattgtccgccacgcacggcggttagagaaggagata
tacgaaaatccaggctctctcccttttcaagagataatatactgcaatcttgggaaccct
caggctcttggccaacgaccaatcaatttctttcgcgaggttctttctctgtgtgacaat
ccatctctcatagacagagacgaagctcgtgcattattcaggttggaccaaatagacaaa
catccatgtgcgctaaaacgagccaggaagattattgaatcacttccaggcagagattct
ggttcctatactagtagtcagggagtcagaggtttgcgtgaagcagttgctgatggaata
gctgccagagatggttttccatcaaaaccagataacatttttctgacagatggagcaagt
tcagcaatcaacatgatgatgcaaatactcatcaggtcccatgaagatggcattttgtgc
ccgctgcctgaatatcccttatactctgcttctattattcttcatggtggaacaatggta
ccgtataatcttactgaagacagtatttgggggcttgagattttcgaagtcaagaggtgt
ttagaggacgcccgtgcatcgggtttgactattagagctatggtggtcataaatcccggc
aatcctactggccaggtactgtctataaccaaccaggaggagattgtggaattctgtagg
aaagaagggttggttattcttgctgatgaggtataccaagaaaatgtctatacagagaat
aagaggttcaattccttcaaaaaggtggccagatcacttggttatgatcaccatgacctc
tctatagtgtcatttcactcggtctctatgggatactatggagaatgtggtagaagggga
ggctacatggagatttgtggttttggagatgatgtgatcgatgagatgtacaagttggct
tctctaactatttgtcccaacatagctggccaaatccttatcagccttgttatggatcca
cctaagctaggggatgaggcttttgagattttcatggtcgagaaggaagagacttattca
tctctactcaagcgcgcaaaggctttgcagaaagcgttcaacggtttggaaggcgtgtcg
tgtaacaagttcgagggagccatgtacctcttcccacggctgcgcctgccacaggcggcg
atcaaagcggcgcagctggagggcgtctcccccgacgtgttctacgcgcaccgcctgctc
gacgccacggggatcgccgtcgtcccaggctctggatttcacccagtctccgggacatcg
cacatccggtgcaccatcctccccggcgaggagacgatcacggcgatggttcccagcctc
caggcgttccatgaggcgttcatggacgagtttcgcggctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4348524
Entry
4348524           CDS       T01015                                 
Name
(RefSeq) alanine aminotransferase 2
  KO
K00814  alanine transaminase [EC:2.6.1.2]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00220  Arginine biosynthesis
osa00250  Alanine, aspartate and glutamate metabolism
osa00710  Carbon fixation in photosynthetic organisms
osa01100  Metabolic pathways
osa01200  Carbon metabolism
osa01210  2-Oxocarboxylic acid metabolism
osa01230  Biosynthesis of amino acids
Module
osa_M00171  C4-dicarboxylic acid cycle, NAD - malic enzyme type
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    4348524
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    4348524
   00220 Arginine biosynthesis
    4348524
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:osa01007]
    4348524
Enzymes [BR:osa01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     4348524
Amino acid related enzymes [BR:osa01007]
 Aminotransferase (transaminase)
  Class I
   4348524
SSDB
Motif
Pfam: Aminotran_1_2 Asp_aminotransf
Other DBs
NCBI-GeneID: 4348524
NCBI-ProteinID: XP_015614438
UniProt: Q338N8 A0A8J8XLP0
LinkDB
Position
10:12967822..12974249
AA seq 483 aa
MAAPSVAVDNLNPKVLNCEYAVRGEIVIHAQRLQQQLQTQPGSLPFDEILYCNIGNPQSL
GQKPVTFFREVIALCDHPCLLEKEETKSLFSADAISRATTILASIPGRATGAYSHSQGIK
GLRDAIAAGIASRDGYPANADDIFLTDGASPGVHMMMQLLIRNEKDGILCPIPQYPLYSA
SIALHGGALVPYYLNESTGWGLEISDLKKQLEDSRLKGIDVRALVVINPGNPTGQVLAEE
NQRDIVKFCKNEGLVLLADEVYQENIYVDNKKFNSFKKIARSMGYNEDDLPLVSFQSVSK
GYYGECGKRGGYMEITGFSAPVREQIYKVASVNLCSNITGQILASLVMNPPKAGDASYAS
YKAEKDGILQSLARRAKALENAFNSLEGITCNKTEGAMYLFPQLSLPQKAIDAAKAANKA
PDAFYALRLLEATGIVVVPGSGFGQVPGTWHIRCTILPQEEKIPAIISRFKAFHEGFMAA
YRD
NT seq 1452 nt   +upstreamnt  +downstreamnt
atggctgctcccagcgtcgccgtcgacaacctcaaccccaaggttttgaattgtgagtat
gcagtgcgtggagagattgtgatccatgctcagcgcctgcagcaacagctacagactcaa
ccagggtctcttccttttgatgagatcctatactgcaacattgggaatccccagtctctt
ggtcagaagccagttacattcttcagggaggttattgctctttgtgatcatccatgcttg
ttggaaaaggaggaaaccaaatcattgttcagtgctgatgccatttctcgagcaacaaca
attcttgcctcgattcctggaagagcaactggagcatacagccacagccagggcatcaaa
gggctgcgtgatgcaattgctgctggaattgcatcacgtgacggataccctgcaaatgca
gacgacattttccttactgacggagcaagccctggagttcacatgatgatgcagttactg
ataaggaacgagaaagatggcattctctgcccaattcctcaatatcctttgtactcagcc
tccattgctcttcatggtggagctcttgtcccgtattatcttaatgaatcaacaggctgg
ggtttggagatctctgaccttaagaagcaactcgaagattctcggttgaaaggcattgat
gttagggctttggtagttatcaatccaggaaatccaactgggcaggttcttgctgaggaa
aaccaacgggacatagtgaagttctgcaaaaatgagggacttgttcttctggctgatgag
gtgtaccaagagaacatctatgttgacaacaagaaatttaactctttcaagaagatagcg
agatccatgggatacaacgaggatgatctccctttagtatcatttcaatctgtttctaag
ggatattatggtgaatgtggcaaaagaggaggctacatggagattactggcttcagtgct
ccagttagagagcagatctacaaagtggcgtcagtgaacttatgttccaatatcactggc
cagatccttgccagcctcgtcatgaatccaccaaaggctggagatgcatcatatgcttca
tacaaggcagagaaagatggaatcctccaatcattagctcgccgtgcaaaggcattggag
aatgctttcaacagtcttgagggaattacatgcaacaaaactgaaggagcaatgtacctc
ttccctcagcttagtctgccacaaaaggcaattgacgctgctaaagctgctaacaaagca
cctgatgctttctatgcccttcgtctcctcgaggcaaccggaattgttgttgtccctgga
tctggatttggccaagttcctggcacatggcacatcagatgcacaatcctgccacaggag
gagaagatccccgcgatcatctcccgcttcaaggcattccatgagggcttcatggcagcg
taccgcgactga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4348525
Entry
4348525           CDS       T01015                                 
Name
(RefSeq) alanine aminotransferase 2
  KO
K00814  alanine transaminase [EC:2.6.1.2]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00220  Arginine biosynthesis
osa00250  Alanine, aspartate and glutamate metabolism
osa00710  Carbon fixation in photosynthetic organisms
osa01100  Metabolic pathways
osa01200  Carbon metabolism
osa01210  2-Oxocarboxylic acid metabolism
osa01230  Biosynthesis of amino acids
Module
osa_M00171  C4-dicarboxylic acid cycle, NAD - malic enzyme type
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    4348525
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    4348525
   00220 Arginine biosynthesis
    4348525
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:osa01007]
    4348525
Enzymes [BR:osa01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     4348525
Amino acid related enzymes [BR:osa01007]
 Aminotransferase (transaminase)
  Class I
   4348525
SSDB
Motif
Pfam: Aminotran_1_2
Other DBs
NCBI-GeneID: 4348525
NCBI-ProteinID: XP_015612787
UniProt: Q338N7
LinkDB
Position
10:12977311..12982476
AA seq 546 aa
MRGDETSSLLFIHPWPPSLEAHHRHTGSLLHSAFLARSPHLTSLTYIAGSIAPSPAANEM
LRAAARALTVSSLNPKVLALADHHLGGLVARRAQSMQQELDANPASHPFSEIIYCNHSNP
QSQGQQPNKFFREVLALCNHPHLLDRSEASFMFSSDAITRAREIVGFIPGKTTGGYSHCQ
GIEGLRDAIAAGIASRDGLPSYSEDIFLTDGAAAPVHMMMHLLIRGKKDGILCPIPSHSL
YTDSMVLRGATLVPYYLDESRGWSVNISDLKKQLDGARAKGIDVRGLVVVNPGNPTGQVL
VEENQCEIVELCKNECLVLLADEVYQENIYTDQKKFNSFKKVARSIGYGEGDISLVSFHS
VSNGYYGECGRRGGYMEVTGFSSEVRGEVYKVASLSACSNISGQILMSLVMNPPKVGDES
YPSYRAERDSILSSLSCCAEAMVSTFNSMEGMTCNKAEGGISVFPSVRLPPRAIEAAEAM
NTEPDVFYALRLLESTGIVVVPGSVFGQVPGTWHFRCTILPQEEKTRQIISRFNVFHEAF
MEEFRS
NT seq 1641 nt   +upstreamnt  +downstreamnt
atgagaggagatgagacgagttccctcctcttcatccatccatggccgcctagcttagag
gctcaccatcgtcacactggctcactgctgcattccgcattcctcgctcgctcacctcac
ctcacctcactcacctacatcgccggatcgatcgcaccgtcgccggcggccaacgagatg
cttcgcgccgccgcccgcgcgctcaccgtcagctccctcaacccaaaggtgctcgcgctg
gcggatcaccacctcggcggactcgtcgcccgccgcgcgcagagcatgcaacaagagcta
gacgctaatccagcttcacatcctttcagtgagatcatctattgcaaccacagcaaccca
cagtcccaagggcagcaaccaaacaagttcttccgggaggttcttgcattgtgtaatcat
ccccatctcctagaccggagtgaggccagcttcatgttcagctctgatgcgataacgagg
gcacgggagattgtaggcttcattcctggaaaaacaactggaggatacagtcactgtcag
ggtattgaagggttgcgtgatgcaattgctgctggaatagcttctcgcgatggtttaccg
tcgtattcggaggacattttcctgacagatggagcagctgcaccggttcatatgatgatg
cacttgttgatacgtggcaagaaggacggcatcctttgcccaattccatcacactctttg
tacacagattctatggttcttcgtggcgcaactcttgtaccgtattaccttgatgaatcc
agaggttggagtgtgaacatttcagatctgaagaaacagttggatggtgcccgggcaaag
ggcattgatgtgaggggacttgtggtggtaaatccgggaaaccctactgggcaggttctt
gtggaggaaaaccagtgtgaaatagtggagctctgcaagaatgaatgccttgttctccta
gcagatgaggtttaccaagaaaacatttacacggatcagaagaaatttaactccttcaag
aaggtagcacggtccataggctatggggaaggggatatatctttagtatcattccactca
gtatctaatggatactacggagaatgcgggagaagagggggttacatggaggtcactggc
ttcagctcggaagtaaggggagaagtatacaaagttgcatccctaagcgcatgctccaac
atatctggccagatccttatgagcctagtcatgaacccaccaaaggttggagatgagtca
tacccctcttatcgtgcagaaagagacagcatactatcatctttgtcttgctgtgcagag
gccatggtgtccacattcaacagcatggaagggatgacttgcaacaaggctgaaggtgga
atatctgtgttccctagtgttcggctgccgccacgggcaattgaagctgctgaggcgatg
aacacagagccggatgtgttctatgctctccgtcttctcgaaagcactgggattgttgtt
gtgcctggctcagtgtttggacaagtacctggaacatggcatttcagatgcacaattctg
ccacaggaagagaagacacggcagattatctcccgctttaatgtgttccatgaagcattt
atggaagaattccgcagctaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9266500
Entry
9266500           CDS       T01015                                 
Name
(RefSeq) alanine aminotransferase 2 isoform X1
  KO
K00814  alanine transaminase [EC:2.6.1.2]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00220  Arginine biosynthesis
osa00250  Alanine, aspartate and glutamate metabolism
osa00710  Carbon fixation in photosynthetic organisms
osa01100  Metabolic pathways
osa01200  Carbon metabolism
osa01210  2-Oxocarboxylic acid metabolism
osa01230  Biosynthesis of amino acids
Module
osa_M00171  C4-dicarboxylic acid cycle, NAD - malic enzyme type
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    9266500
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    9266500
   00220 Arginine biosynthesis
    9266500
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:osa01007]
    9266500
Enzymes [BR:osa01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     9266500
Amino acid related enzymes [BR:osa01007]
 Aminotransferase (transaminase)
  Class I
   9266500
SSDB
Motif
Pfam: Aminotran_1_2
Other DBs
NCBI-GeneID: 9266500
NCBI-ProteinID: XP_015629269
LinkDB
Position
3:complement(4383981..4390417)
AA seq 482 aa
MATGVSVENINPKVLRCEYAVRGEVAIHAQHLQQQLQTQPGSLPFDEIVYCNIGNPQSLG
QKPITFFREVLALCNHPNLLEREEIKSLFSTDAIARAKKILSMIPGRATGAYSHSQGIKG
LRDEIAAGIASRDGFPANADDIFLTNGASPGVHMMMQLLIRNNRDGIMCPIPQYSLYSAS
LALHGGALVPYYLDESSGWGLEVSKLKNQLEDARSKGITVRALVVINPGNPTGQILDEQQ
QYELVKFCKDEELVLLADEVYQENIYVTNKKINSFKKIARSMGYNGDDLQLVSLHSVSKG
YYGECGKRGGYMEVTGFSTPVREQLYKIASVNLCSNITGQILASLIMDPPKAGDASYDLY
EEEKDNILKSLSRRAKAMESAFNSIDGITCNKTEGAMYLFPRIYLPQKAIEAARAVNKAP
DVFYALRLLDTTGIVVTPGSGFGQVAGTWHVRCTILPQEEKIPSMISRFREFHEEFMSQY
RD
NT seq 1449 nt   +upstreamnt  +downstreamnt
atggccactggtgtttctgttgagaacataaaccccaaggttttacgatgtgaatatgca
gttcgtggagaggttgccatccatgctcagcacctacaacagcagctacagacacaacct
ggttctcttccatttgatgagatcgtgtattgcaacatcgggaaccctcagtccttgggt
caaaaaccaatcacattcttcagggaggttcttgcactttgcaatcatccaaatctgctg
gagagagaggaaattaaatcattgttcagcactgatgctattgctcgggcaaagaaaatt
ctttccatgattcctggaagagccaccggggcatatagtcatagccagggtatcaaggga
ctgcgtgatgagattgctgctgggattgcctcccgtgatggtttccctgcaaatgcagat
gatatattcctaactaatggagcaagtcctggtgtacacatgatgatgcagttgctgata
aggaacaacagagatggcattatgtgtccaattcctcaatactcattgtactcagcatcc
ctagcacttcatggcggagctcttgtgccatattatcttgatgaatcctcaggatggggt
ttggaggtttctaagcttaagaatcaacttgaagatgccaggtcaaaaggcataactgtt
agggcgttggtggtgatcaatcctggaaatcctactggacagattcttgatgagcaacag
caatatgagctagtaaagttctgcaaggacgaggaacttgttcttctggcggatgaggta
taccaagagaacatttatgttaccaacaagaagatcaactctttcaagaagatagcaaga
tccatgggatacaatggagacgatttacaattagtatcattgcattctgtttctaaagga
tattacggagagtgtggcaagagaggcggttacatggaggtcactggcttcagcactcca
gttagagaacaactctacaaaattgcatctgttaacttgtgttcaaatatcaccggccag
atccttgcgagcctcataatggatccaccaaaggctggggacgcatcttatgacctctac
gaggaagagaaagacaacatcctaaaatctttatctcgtcgtgcaaaggcaatggagtct
gcatttaacagtattgatggaattacatgcaacaagacggaaggggcgatgtatctgttc
ccacggatttatctaccacagaaggcaattgaggctgccagggctgtcaacaaagcacct
gatgtattctacgctctacgtcttcttgataccaccggcatcgttgtgactcctggatct
ggttttggacaagttgcagggacatggcacgtgagatgcacgatcctgccgcaggaggag
aagataccttcgatgatctcccgcttcagggaattccatgaggagttcatgtcacagtat
cgcgactga

DBGET integrated database retrieval system