KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4342408
Entry
4342408           CDS       T01015                                 
Name
(RefSeq) 40S ribosomal protein S12
  KO
K02951  small subunit ribosomal protein S12e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4342408
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4342408
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Small subunit
    4342408
SSDB
Motif
Pfam: Ribosomal_L7Ae
Other DBs
NCBI-GeneID: 4342408
NCBI-ProteinID: XP_015644654
UniProt: A0A8J8YES7 Q6ZLP8
LinkDB
Position
7:2613883..2616324
AA seq 138 aa
MAEETPVETPAAPVLGEPMDLMTALQLVMKKSSAHDGLVKGLREAAKAIEKHAAQLCVLA
EDCDQPDYVKLVKALCAEHNVHLVTVPSAKTLGEWAGLCKIDSEGKARKVVGCSCVVVKD
YGEESEGLNIVQDYVKSH
NT seq 417 nt   +upstreamnt  +downstreamnt
atggcggaggagaccccagttgagactccagctgccccggttcttggggagcccatggat
ctgatgactgctctgcagcttgtgatgaagaagtcaagtgctcatgatgggcttgtgaag
ggtctccgtgaggctgccaaggccatcgagaagcatgctgctcagctttgtgtgcttgct
gaggactgcgaccaacctgattatgtcaagttggttaaggctctgtgtgctgagcacaac
gttcaccttgttaccgtgcctagtgctaagactcttggcgagtgggcagggctttgcaag
attgactctgagggcaaggcaaggaaggttgtgggctgctcctgcgtcgttgtcaaggac
tatggtgaagagtctgagggccttaacatagtgcaggactatgtcaaatcgcactag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4342771
Entry
4342771           CDS       T01015                                 
Name
(RefSeq) 40S ribosomal protein S12
  KO
K02951  small subunit ribosomal protein S12e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4342771
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4342771
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Small subunit
    4342771
SSDB
Motif
Pfam: Ribosomal_L7Ae
Other DBs
NCBI-GeneID: 4342771
NCBI-ProteinID: XP_015644758
UniProt: Q8H2J8 Q0D7N0
LinkDB
Position
7:complement(7233157..7235205)
AA seq 138 aa
MAEETPVEAPPAPVLGEPMDLMTALQLVMKKSSAHDGLVKGLREAAKAIEKHAAQLCVLA
EDCDQPDYVKLVKALCAEHNVHLVTVPSAKTLGEWAGLCKIDSEGKARKVVGCSCVVVKD
FGEESEGLNIVQDYVKSH
NT seq 417 nt   +upstreamnt  +downstreamnt
atggcggaagagactccagttgaggccccacctgccccggttcttggagagccgatggac
ctgatgactgctctgcagcttgtgatgaagaagtcaagcgctcatgatgggctcgtgaag
gggctccgtgaggcggccaaggccattgagaagcatgccgctcagctttgcgtgcttgct
gaggactgtgaccagcctgattatgtcaagttggtcaaggcactctgcgctgagcacaat
gttcacctcgttaccgtgcctagtgctaaaactcttggcgagtgggcagggctttgcaag
attgattctgagggcaaggcgaggaaggtcgtaggctgctcctgcgtcgttgtcaaggac
ttcggtgaagagtcagagggcctcaacatagtccaggactatgtcaagtcccactag

DBGET integrated database retrieval system