KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4342480
Entry
4342480           CDS       T01015                                 
Name
(RefSeq) proline--tRNA ligase, chloroplastic/mitochondrial
  KO
K01881  prolyl-tRNA synthetase [EC:6.1.1.15]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    4342480
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:osa01007]
    4342480
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:osa03016]
    4342480
Enzymes [BR:osa01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.15  proline---tRNA ligase
     4342480
Amino acid related enzymes [BR:osa01007]
 Aminoacyl-tRNA synthetase
  Class II (C/G)
   4342480
Transfer RNA biogenesis [BR:osa03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    4342480
 Prokaryotic type
    4342480
SSDB
Motif
Pfam: tRNA-synt_2b ProRS-C_1 HGTP_anticodon
Other DBs
NCBI-GeneID: 4342480
NCBI-ProteinID: XP_015647822
UniProt: Q7XID8
LinkDB
Position
7:3481113..3485918
AA seq 545 aa
MASLLRLPSLLKPSAAAARPSALLRRRCRAGTAASVSASRSQAAAATTGAAAPAPPETRG
GGDREGQVTPRSVDFNAWYTDVIAAAELADYGPVRGTMVIRPYGYAIWEAIQDYLNVKFK
ETGHSNMYFPQFIPYSFIEKEASHVEGFSPELALVTIGGGKELEEKLVVRPTSETIVNHM
FTKWIQSYRDLPLMINQWANVTRWEMRTKPFIRTLEFLWQEGHTAHATLEEAEKEAMQMI
DVYTKFAYEQAAIPVIPGRKSRVETFAGANRTYTIEAMMGDRKALQAGTSHNLGQNFSRA
FGTQFMDENSQIEHVWQTSWAISTRFVGGIIMTHGDDAGLMLPPNIAPIQVVIVPIWKKG
DEKSAVMEAVSSVQNTLKEAGIRVKVDDSELRTPGWKFNFYEMKGVPIRLEIGPRDVTNK
SVVISRRDIPGKQGKEFGVSMDPSILVDHIKGRLVEIQASLLQKAIAFRDSNIVDVSSYG
ELKEAIAEGKWARGPWSASDADELKVKEETSATIRCFPFEQPEGAKKCFMTGNPAEEVAI
FAKSY
NT seq 1638 nt   +upstreamnt  +downstreamnt
atggcgtcgctgctgcgcctcccctcgctgctcaagccgtcggcggcggcggctaggccg
tcggcgctgctccgccgccggtgccgcgccgggacggcggcgagcgtgtccgcctcgcgg
agccaagccgcggcggcgaccacgggggcggcggcgcccgcgccgcctgagacccgcggc
gggggggacagggaggggcaggtgacgccgcggtcggtggacttcaacgcgtggtacacc
gatgtgatcgccgccgccgagctcgcggactacgggcccgtgcggggcaccatggtcatc
cgcccctacggctacgccatctgggaggccatccaggattatttgaatgtgaagttcaag
gaaacagggcacagcaacatgtacttccctcagttcataccatactcatttatagagaag
gaggccagccatgttgaaggttttagtccagagcttgcattagttaccattggaggagga
aaggaactagaggaaaagcttgtggtaagaccaactagtgagaccatcgtaaaccacatg
ttcaccaaatggatacagagctaccgcgatcttcctctcatgattaaccagtgggctaat
gtcacaagatgggaaatgaggactaagccattcatcagaactcttgaatttctatggcaa
gaaggtcatacagctcatgccacccttgaagaggcagaaaaggaggcaatgcaaatgatt
gatgtatatacaaaatttgcatacgagcaagctgcaatccctgttattccgggtcgaaaa
tcaagagtggaaacgtttgctggtgctaatcggacctacactatagaagctatgatgggt
gacaggaaggctttacaggctggaaccagccacaaccttggacagaacttctcccgtgcc
tttggaacacagtttatggatgaaaatagccaaatcgaacatgtttggcagacttcttgg
gctattagcactcggtttgttggtgggatcatcatgacccatggtgatgatgctggctta
atgcttccgccaaatattgcacccatccaggtggtaatagtgcctatatggaaaaaggga
gatgaaaagagtgctgttatggaagctgtgtcttcagttcaaaacacactcaaagaagca
ggaattagagtcaaagtggatgactcggagttgcggacaccaggatggaagttcaatttt
tacgagatgaagggagttcctataagactagaaattggtccccgtgatgtcacaaacaaa
agtgttgttatttctaggcgagatatccctggaaaacaaggaaaggagtttggagtgtct
atggatccatcaatactggtggaccatataaaaggtcgtctagtggaaatccaagcatcc
cttctacagaaggccattgcattccgtgatagtaacatagttgatgtaagctcatatgga
gaactgaaggaggccattgccgagggtaaatgggcgagagggccatggtcagctagcgat
gctgatgagctgaaggtgaaagaagagaccagcgccaccatcagatgcttcccgttcgag
cagccagagggcgctaagaaatgcttcatgactggcaatccagccgaggaagttgcaatt
tttgcgaagtcgtattag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4352148
Entry
4352148           CDS       T01015                                 
Name
(RefSeq) proline--tRNA ligase, cytoplasmic
  KO
K01881  prolyl-tRNA synthetase [EC:6.1.1.15]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    4352148
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:osa01007]
    4352148
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:osa03016]
    4352148
Enzymes [BR:osa01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.15  proline---tRNA ligase
     4352148
Amino acid related enzymes [BR:osa01007]
 Aminoacyl-tRNA synthetase
  Class II (C/G)
   4352148
Transfer RNA biogenesis [BR:osa03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    4352148
 Prokaryotic type
    4352148
SSDB
Motif
Pfam: ProRS-C_1 HGTP_anticodon tRNA-synt_2b PhaP_Bmeg
Other DBs
NCBI-GeneID: 4352148
NCBI-ProteinID: XP_015620497
UniProt: A0A8J8YLS1 Q2QS11
LinkDB
Position
12:complement(14897144..14904687)
AA seq 510 aa
MSSGKGGGGGGKGGGGKKKEVKKETKLGMAYKKDDNFGEWYSEVVVNSEMIEYYDISGCY
ILRPWAMEIWELLKEFFDAEIKKLKLKPYYFPLFVTENVLQKEKDHIEGFAPEVAWVTKS
GKSDLEAPIAIRPTSETVMYPYFSKWIRSHRDLPLRCNQWCNVVRWEFSNPTPFIRSREF
LWQEGHTAFATKEEADEEVLQILELYRRIYEEFLAVPVSKGRKSEMEKFAGGLYTTSVEA
FIPNTGRGVQGATSHCLGQNFAKMFDITFENDKGSRSMVWQNSWAYTTRSIGVMVMTHGD
DKGLVLPPRVAPLQVIVIPVPYKDVDTTAIVNECKKTVETLEKAGIRADLDTRENYSPGW
KYSHWEMKGVPLRIEIGPKDMANNQARVVRRDNGAKADIPTADLVEKVNGLLDEVQKNLF
ETAKQKRDACLKVVNTWDEFIVALNDKKLILAPWCDEEEVEKDVKARTKGDLGAAKTLCT
PFEQPDLPEGTTCFASGKPAKKWSFWGRSY
NT seq 1533 nt   +upstreamnt  +downstreamnt
atgtcgtccgggaagggaggtggaggcggcggcaagggaggcggagggaagaagaaggag
gtgaagaaggagacgaagctcgggatggcgtacaagaaggatgacaacttcggggagtgg
tactccgaggttgtcgttaacagtgaaatgatcgagtactatgacatatccggttgttat
atcttgaggccatgggcgatggagatctgggaattgcttaaagaattctttgatgcagaa
ataaaaaagctgaagctgaaaccttattatttcccattgtttgtcactgagaatgtccta
cagaaggagaaagaccacattgagggctttgcaccagaggtagcatgggtcactaaatca
ggaaaatctgatctggaagctcctatcgcaatccgtcctacaagtgagactgtcatgtat
ccatacttctccaaatggataagaagtcatcgggacttacctttgaggtgtaaccagtgg
tgtaacgtcgtgcgatgggagtttagcaatccaactccattcataaggagccgtgagttc
ctttggcaagaagggcatacagcttttgcaactaaagaggaggctgacgaagaggttctc
caaattttggaactctaccgaaggatttatgaagaatttttagcagttccagtttctaaa
gggaggaaaagtgagatggaaaaatttgctggtggactgtatacaacaagtgttgaggcc
ttcattccaaacacaggacgtggtgtacaaggggcaacatcacattgtcttggtcaaaac
tttgcaaagatgtttgatatcacttttgagaatgataagggctcaagatccatggtgtgg
cagaactcttgggcatacaccacccgctcgattggggtgatggtgatgacacacggagat
gacaaaggtttagtgcttccaccaagggtggcacctctgcaggtcattgttattcctgtt
ccatacaaagatgttgacacaacagctattgtaaacgaatgcaaaaagactgttgagaca
ctggagaaagctggtattcgagcagacttggatacccgcgaaaactattctccaggatgg
aagtattcccactgggagatgaaaggcgttcctctaagaattgagataggtccaaaagat
atggcaaacaatcaggcccgtgttgttaggcgagacaatggtgcaaaagctgatattcct
acggctgacttggttgagaaagttaatgggttacttgatgaggttcagaaaaacttgttt
gagacggcgaaacaaaagagagatgcctgccttaaggttgttaacacctgggatgaattc
atagtggctctgaatgacaaaaaattgatcctggctccatggtgtgatgaagaggaagtt
gagaaggatgtgaaggctcggacaaaaggtgacctgggagctgccaagacattgtgtaca
ccatttgaacagccagatctcccagaaggaaccacatgctttgcttctggaaagcctgcg
aagaaatggtcattctggggccgcagctattga

DBGET integrated database retrieval system