KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4342505
Entry
4342505           CDS       T01015                                 
Name
(RefSeq) uncharacterized protein LOC4342505
  KO
K18054  2'-deoxymugineic-acid 2'-dioxygenase / mugineic-acid 3-dioxygenase [EC:1.14.11.24 1.14.11.25]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00999  Biosynthesis of various plant secondary metabolites
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00999 Biosynthesis of various plant secondary metabolites
    4342505
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.24  2'-deoxymugineic-acid 2'-dioxygenase
     4342505
    1.14.11.25  mugineic-acid 3-dioxygenase
     4342505
SSDB
Motif
Pfam: 2OG-FeII_Oxy DIOX_N
Other DBs
NCBI-GeneID: 4342505
NCBI-ProteinID: XP_015645868
LinkDB
Position
7:3699596..3704922
AA seq 708 aa
MEKLLSSSGAAAAVASQGQLPDCFVFPADRRPPASTAAVSLPVIDLSGPRDAVRRAVLDA
GKELGFFQVVNHGVPPETMREMAAVCEEFFRLPAEDKAAFYSDAEENPNRLFSSTIYEVG
DQRYWRDCLRLACGFPVADDTNTHWPDKPHHLRDVTEKFFVATRGLGIELLRLLCEGMGL
RPDYFERDLTAGDVIINVNHYPPCPDPSLTLGLPPHCDRNLITLLLQGDVFGLQVSYNGD
WINVDPVPDAFVVNFGHLLEIATNGVLKSIEHRAMTNSAVARTSVATFMMPPMDCLVGPA
KELVGDGGQPQYRTVTFREFMRIYKTVGARRDSVEKAFKISMAAVVFDAAILSKQEAIPA
QFVWPADEAPAADDGVVEEIAIPVVDLAAFLASGGIGRDVAEACERHGFFQVVNHGVDPA
LLAEAYRCCDAFYARPLAEKQRARRRPGENHGYASSFTGRFDCKLPWKETMSFNCSAAPG
NARMVADYFVDALGEEYRHMGEVYQEYCDVMTRLALDVTEVLAVALGLGRGELRGFFADG
DPVMRLNHYPPCRQPHLTLGTGPHRDPTSLTLLHQDDVGGLQVLPDDAAAAAGGWRAVRP
RADAFVVNIGDTFAALTNGRHASCLHRAVVNGRVARRSLTFFLNPRLDRVVSPPPALVDA
AHPRAFPDFTWREFLEFTQRHYRSDTNTMDAFVAWIKQRNGYESLDKY
NT seq 2127 nt   +upstreamnt  +downstreamnt
atggagaagttgctttcctcctccggcgccgccgccgccgtggcgtcgcagggccagctc
ccggactgcttcgtgttcccggccgaccggcgcccaccggcctccaccgcggccgtgtcg
ctccccgtcatcgacctctccggcccccgcgacgccgtccgccgcgccgtcctcgacgcc
ggcaaggagctcggcttcttccaggtggtgaaccacggcgtgccgccggagacgatgcgg
gagatggcggcggtgtgcgaggagttcttccggctgccggcggaggacaaggcggcgttc
tactccgacgcggaggagaaccccaaccgcctcttctccagcaccatctacgaggtcggc
gaccagcgctactggcgcgactgcctccgcctcgcctgcggcttccccgtcgccgacgac
accaacacccactggcccgacaagccccaccatctccgggatgtcacggagaagttcttc
gtggcgacgaggggattggggatcgagctgctgcggctgctgtgcgaggggatggggctc
aggccggactacttcgagcgcgacctcaccgccggcgatgtcatcatcaacgtcaaccac
taccctccatgcccggatccgagcctgacgctgggcttgccgccgcactgcgaccgcaac
ctcatcaccctgctcctccagggcgacgtcttcggcctccaggtctcctacaatggcgac
tggatcaacgtcgaccccgtccccgacgccttcgtcgtcaactttggccacctcctcgag
attgcgacgaacggagtgctgaagagcatcgagcacagggcgatgacgaactcggcggtg
gcgaggacgtcggtggcgacgttcatgatgccgccgatggactgcctcgtcggaccggcg
aaggagctcgtcggagacggcggccagccgcagtatcgcaccgtcacgttccgcgagttc
atgcgcatctacaagaccgtcggcgcgcgccgcgacagcgtcgagaaggccttcaaaatc
tccatggcagccgtggtgttcgacgcggcgatcctgagcaagcaggaggcgatcccggcg
cagttcgtctggccggccgacgaggcgccggcggcggacgacggcgtggtggaggagatc
gccatccccgtcgtcgacctggccgcgttcctcgccagcggcggcattgggcgcgacgtg
gcggaggcgtgcgagcggcacgggttcttccaggtggtgaaccacggcgtcgacccggcg
ctgctcgccgaggcgtaccgctgctgtgacgcgttctacgcgcggccgctcgccgagaag
cagcgcgcgcggcgccgccccggcgagaaccacggctacgcgagcagcttcacggggcgg
ttcgactgcaagctgccgtggaaggagaccatgtcgttcaactgctccgccgcgccgggg
aacgcgcgcatggtcgccgactatttcgtcgacgccctcggcgaggaataccgccacatg
ggggaggtgtaccaggagtactgcgacgtgatgacgcggctggcgctggacgtgacggag
gtgctcgcggtggcgctcgggctcggccgcggcgagctccgcggcttcttcgccgacggc
gacccggtgatgcggctgaaccactacccgccgtgccggcagccgcacctgacgctgggc
acgggcccgcaccgcgacccgacgtcgctgacgctgctccaccaggacgacgtcggcggc
ctgcaggtgctccccgacgacgccgcggcggcggcgggcgggtggcgcgccgtgcgcccg
cgcgccgacgcgttcgtcgtcaacatcggcgacacgttcgcggcgctcaccaacgggcgc
cacgccagctgcctccaccgcgccgtggtgaacggccgcgtcgcgcgcaggtcgctcacc
ttcttcctcaacccgcgcctcgaccgcgtcgtgtcgccgccgccggcgctcgtcgacgcc
gcgcacccgcgcgcgttcccggacttcacgtggcgcgagttcctcgagttcacgcagagg
cactaccggtcggacaccaacaccatggacgccttcgtcgcctggatcaagcaaaggaat
ggctatgaaagcctcgacaagtactag

DBGET integrated database retrieval system