KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4342563
Entry
4342563           CDS       T01015                                 
Name
(RefSeq) 60S ribosomal protein L4-1
  KO
K02930  large subunit ribosomal protein L4e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4342563
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4342563
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    4342563
  Archaea
    4342563
SSDB
Motif
Pfam: Ribosomal_L4 Ribos_L4_asso_C
Other DBs
NCBI-GeneID: 4342563
NCBI-ProteinID: XP_015647011
UniProt: Q6ZLB8 A0A8J8XHR7
LinkDB
Position
7:4263168..4265662
AA seq 405 aa
MATQTRPLVSVKALEGDMATDNSSSLALAEVFRAPLRPDVVRFVHRLLSCNKRQPYAVSR
RAGHQTSAESWGTGRAVSRIPRVPGGGTHRAGQGAFGNMCRGGRMFAPTKTWRKWHRRVN
VHLRRVAVASALAATSVPSLVLARGHRIETVPELPLVISDSAESIEKTSQAIKILKQVGA
YADAEKAKDSVGIRPGKGKMRNRRYINRKGPLIVYGTEGSKIVKAFRNLPGVDVANVERL
NLLDLAPGGHLGRFVIWTESAFKKLEEVYGTFEAPSLKKKGFILPRPKMANADLGRIINS
DEVQSVVKPLNKEVKRREKRKNPLKNVAAVLKLNPYFGTARKMATLAEAARIKARKEKLD
SKRTKLSPEEAAKVKAAGKAWYKTMISDSDYAEFDNFSKWLGVTQ
NT seq 1218 nt   +upstreamnt  +downstreamnt
atggccacccaaacccgccccctcgtctccgtcaaggccctggagggcgacatggccacc
gacaacagcagcagcctcgccctcgccgaggtgttccgcgcgccgctccgccccgacgtg
gtccgcttcgtccacaggctgctctcctgcaacaagcgccagccctacgccgtgtcccgc
cgcgccggccaccagacctcggcggagtcgtggggcacggggcgcgccgtgtcgcgtatc
ccccgcgtccccggcggcgggacgcaccgcgccgggcagggagccttcggcaacatgtgc
cgcggcgggcgcatgttcgcgccgaccaagacatggcgcaagtggcaccgccgcgtcaac
gtccacctccgccgcgtcgccgtcgcctccgccctcgccgccacctccgtcccgtccctc
gtcctcgcccgcggccaccgcatcgagaccgtccccgagctccccctcgtcatttccgac
tccgccgagtccatcgagaagacctcccaggccatcaagatcctgaagcaggtcggcgcc
tacgccgacgccgagaaggccaaggactccgtcggcatccgccccggcaagggtaagatg
cgcaaccgccgctacatcaaccgcaagggccccctcatcgtctacggcaccgagggatcc
aagatcgtcaaggccttccgcaacctccccggcgtggatgtcgccaacgtcgagcgcctc
aacctgctcgacctcgcacccggtggtcacctcgggcgcttcgtgatctggaccgagagc
gccttcaagaagcttgaggaggtgtatggcaccttcgaggcgccgtcgctgaagaagaag
gggttcatcctgccgaggcccaagatggccaatgctgatcttggcaggatcatcaactct
gatgaggtgcagtctgtggtgaagccgctcaacaaggaggtcaagcgcagggagaagagg
aagaacccgctcaagaatgtcgccgctgtgctcaagctcaacccctacttcggcactgca
cgcaagatggccacccttgctgaggctgcccgcatcaaggccaggaaggagaagcttgac
tccaagaggaccaagcttagcccggaggaggctgctaaggttaaggctgcaggaaaggca
tggtacaagaccatgatctcagacagtgactatgctgagttcgacaacttctcgaagtgg
ctcggagtgacgcagtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9272589
Entry
9272589           CDS       T01015                                 
Name
(RefSeq) 60S ribosomal protein L4
  KO
K02930  large subunit ribosomal protein L4e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    9272589
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    9272589
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    9272589
  Archaea
    9272589
SSDB
Motif
Pfam: Ribosomal_L4 Ribos_L4_asso_C
Other DBs
NCBI-GeneID: 9272589
NCBI-ProteinID: XP_015632250
UniProt: C7IZI5
LinkDB
Position
3:complement(33143630..33146063)
AA seq 404 aa
MAAAARPLVSVKALEGDMATDSAGIQMPQVLRAPIRPDVVTFTHKLLSCNRRQPYAVSRR
AGHQTSAESWGTGRAVSRIPRVPGGGTHRAGQGAFGNMCRGGRMFAPTKIWRRWHRRVNI
RLRRIAVASALAATAVPSLVLARGHRIEGVPEFPLVVSDSIESIEKTAQSIKVLKQIGAY
ADAEKTKDSVAIRAGKGKMRNRRYINRKGPLIVYGTEGSKVVKAFRNLPGVDVANVERLN
LLDLAPGGHLGRFVIWTECAFKKLDEVYGGFDTPALKKKGFVLPRPKMANADLSRLINSD
EVQSVVKPINKEVKLREARRNPLKNVAAVLKLNPYFGTARKMAALAEAARVKARTEKLDS
KRTKLSPEESSKIKAAGKAWYKTMISDSDYTEFENFSKWLGVTQ
NT seq 1215 nt   +upstreamnt  +downstreamnt
atggccgccgccgcgcgccccctggtgtccgtgaaggccctggagggcgacatggcgacg
gactcggccggcatccagatgccgcaggtgctccgcgcgccgatccgccccgacgtggtc
accttcacccacaagctcctctcctgcaaccgccgccagccgtacgccgtgtcgcgccgc
gcggggcaccagacctccgcggagtcgtggggcacgggccgcgccgtgtcccgcatcccg
cgcgtccccggcggcggcacgcaccgcgcggggcagggcgcgttcggcaacatgtgccgc
ggcgggcgcatgttcgcgcccaccaagatctggcgccgctggcaccgccgcgtcaacatc
cgcctccgccgcatagccgtcgcgtccgcgctcgccgccaccgccgtcccgtccctcgtc
ctcgcccgcggccaccgcatcgagggcgtccccgagttcccgctcgtcgtctcggactcc
atcgagtccatcgagaagactgcgcagtccatcaaggtcctcaagcagattggtgcctac
gctgatgccgagaagaccaaggattcggtggccatccgcgctggcaaggggaagatgcgc
aaccgccggtacatcaatcgcaagggccccctcatcgtctacggcaccgagggttccaag
gtcgtcaaggctttccgcaacctccccggcgttgatgttgccaatgtggagcgcctcaac
ctgctcgaccttgcccctggtggccaccttggccgcttcgtgatctggaccgagtgcgcg
ttcaagaagctcgacgaggtgtatggtggcttcgacacaccggcgctgaagaagaagggc
ttcgtgctcccgaggccgaagatggcgaatgccgacctgtccaggctgatcaactccgat
gaggtccagtcggtggtgaagcccatcaacaaggaggtgaagctcagggaggcgagaagg
aaccctctgaagaatgtggccgctgtgctcaagctgaacccctacttcggcactgcgcgc
aagatggcagctctcgctgaggctgcgcgtgtcaaggccaggactgagaagctcgactcc
aagaggaccaagctcagcccggaggagtcttctaagatcaaggctgctggaaaggcatgg
tacaaaaccatgatttctgacagtgactacacagagtttgagaatttctcgaagtggctt
ggtgtgacgcagtga

DBGET integrated database retrieval system