KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4342584
Entry
4342584           CDS       T01015                                 
Name
(RefSeq) ATP-dependent DNA helicase 2 subunit KU70 isoform X1
  KO
K10884  ATP-dependent DNA helicase 2 subunit 1
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    4342584
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:osa03041]
    4342584
   03400 DNA repair and recombination proteins [BR:osa03400]
    4342584
Spliceosome [BR:osa03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    4342584
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    DNA-PK complex
     4342584
SSDB
Motif
Pfam: Ku_N Ku Ku_C SAP SAP_new25 HeH Ish1
Other DBs
NCBI-GeneID: 4342584
NCBI-ProteinID: XP_015646738
UniProt: Q7F1M0
LinkDB
Position
7:4485182..4496250
AA seq 624 aa
MDLDPEGLFRDDSDEDDDNVQEREANKEMVVYLIDASPKMFTPATKADEKEETHFHTIVN
CITHALKTQIIGRSYDEVAICFFNTKEKKNLQELAGVYVYNVTEREPLDRPDARLIKEFS
CIEDSFMSNIGSRYGITSGSRENTLYNALWVAQALLRKGSVKTVSKRIVIFTNEDDPFGG
LTGAVKTDMIRTTIQRARDAQDLGLSIELLPLSRPDEEFNMSLFYADLIGLEGDEIVDYL
PSSGEKLEDMTNQLKKRMMKKRKVKTLAFAITNDVCIEVNTYALIRSTTPGAITWLDSIS
NLPLKAERSFICNDTGALIQDPQKRFQVYNDKIVKFSTRELSDVKRVSSHHLRLLGFKPL
DYLKDYHNLRPSTFIYPSDEQIFGSTRVFVALHSSMRRLGRFALAFYGNPTRPQLVALIA
QEEVTSAGGQIEPPGIHMIYLPYSDDVRYPEEVHLTSDDAPRATDEQIKKASNLLRRIDL
KNFSVCQFSNPALQRHYGILEALALGEDEMPDVKDETLPDEEGLARPVVVKAVEEFKASV
YGENYDQEEAEAAAAKAGASKKRKALTDAAAEKSAAHNWAELADTGKLKDMTVVDLKSYL
SAHGLPVSGKKEALVSRILTHLGK
NT seq 1875 nt   +upstreamnt  +downstreamnt
atggatctggaccccgagggcctcttccgcgacgacagcgacgaggatgacgacaacgtc
caggagagggaggccaacaaggagatggtcgtctacctcatcgacgcctcgcccaagatg
ttcacccctgcgaccaaggcagatgaaaaggaggagacacattttcatacgatagtgaac
tgcatcacacatgcgctgaagacgcagattatcggtagatcctatgatgaagtcgctata
tgtttctttaacacgaaagaaaagaagaatttacaggaattggctggtgtttatgtttat
aatgttacagagagagaaccacttgataggcctgatgcaagattgattaaggaattttct
tgtatagaagattcttttatgagtaatattggaagtcggtacggaataacttctggatct
cgagagaataccttgtacaatgctctttgggttgcacaggcattgctgcgtaaaggatct
gtgaagactgtgagtaagcggattgttatattcaccaacgaagatgatccttttggtggt
cttacaggagcagtaaagactgatatgataaggacaacaatccaacgtgcaagagatgca
caagatcttggcctgtccattgaacttcttcctttgagtaggcccgatgaggagttcaac
atgtccctgttttatgcagatttaattggtctggagggagatgaaatagtggattatctg
ccatcttctggtgaaaagctggaggatatgactaatcagctgaaaaaacgaatgatgaag
aaacgcaaagtcaaaactcttgcatttgcaattaccaatgatgtttgcatagaggtgaat
acatatgcgctaatccgttcaactactccaggggcaattacatggcttgattctatcagc
aacctgccattgaaggctgaaaggtctttcatatgcaatgacactggggcccttattcag
gatccacaaaagcgcttccaggtgtacaatgacaaaattgttaaattctctactcgtgaa
ttgtctgatgtgaagagggtttcaagtcatcatctacgccttttaggattcaagccactg
gactaccttaaagattatcacaacttaagaccgtcaacatttatttaccccagtgatgag
caaatatttggaagcactcgtgttttcgttgctttacatagctcaatgcggcgtcttgga
aggtttgcacttgcattttacgggaatccaactcgcccacaacttgtagcccttattgca
caagaagaggttacttctgctggtggtcaaattgaaccacctggaatacacatgatctat
cttccatactcggatgatgttagatatcctgaggaggttcatctgacttctgatgatgca
cctcgtgccacagatgaacaaattaagaaagcttcaaatctattgagacgtattgatttg
aagaacttctcagtatgccaattttctaacccagcattgcaaagacactatgggatcttg
gaggccttagctttaggtgaagatgagatgccagatgtcaaggatgaaacccttcctgat
gaagagggcttggctaggccagtagtagttaaagctgtcgaggaatttaaggcttcagtc
tatggtgaaaattatgatcaagaggaagccgaggcagcagcagcgaaggctggggcttca
aagaagaggaaagcacttactgatgcagctgcagagaaaagtgcagcacataattgggca
gaacttgcggatactggaaagctgaaggacatgacggtggtggacttgaaatcttacctg
agtgcacatggcctcccagtttctggaaagaaagaggcactcgtcagcagaatcttgact
catctaggcaagtga

DBGET integrated database retrieval system