KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4342610
Entry
4342610           CDS       T01015                                 
Name
(RefSeq) methylmalonate-semialdehyde dehydrogenase [acylating], mitochondrial
  KO
K00140  malonate-semialdehyde dehydrogenase (acetylating) / methylmalonate-semialdehyde dehydrogenase [EC:1.2.1.18 1.2.1.27]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00280  Valine, leucine and isoleucine degradation
osa00410  beta-Alanine metabolism
osa00562  Inositol phosphate metabolism
osa00640  Propanoate metabolism
osa01100  Metabolic pathways
osa01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    4342610
   00562 Inositol phosphate metabolism
    4342610
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    4342610
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    4342610
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.18  malonate-semialdehyde dehydrogenase (acetylating)
     4342610
    1.2.1.27  methylmalonate-semialdehyde dehydrogenase (CoA-acylating)
     4342610
SSDB
Motif
Pfam: Aldedh FmdE
Other DBs
NCBI-GeneID: 4342610
NCBI-ProteinID: XP_015647227
UniProt: A0A0P0X3K0 Q6Z4E4
LinkDB
Position
7:4734593..4741434
AA seq 534 aa
MLRAALLRSGSGLRRPPMAAPLSTAAAASWLSDSASSPPRVRLLIGGEFVESRADEHVDV
TNPATQEVVSRIPLTTADEFRAAVDAARTAFPGWRNTPVTTRQRIMLKYQELIRANMDKL
AENITTEQGKTLKDAWGDVFRGLEVVEHACGMGTLQMGEYVSNVSNGIDTFSIREPLGVC
AGICPFNFPAMIPLWMFPIAVTCGNTFVLKPSEKDPGAAMMLAELAMEAGLPKGVLNIVH
GTHDVVNNICDDEDIKAVSFVGSNIAGMHIYSRASAKGKRVQSNMGAKNHAIILPDADRD
ATLNALIAAGFGAAGQRCMALSTAVFVGGSEPWEDELVKRASSLVVNSGMASDADLGPVI
SKQAKERICKLIQSGADNGARVLLDGRDIVVPNFENGNFVGPTLLADVKSEMECYKEEIF
GPVLLLMKAESLDDAIQIVNRNKYGNGASIFTTSGVSARKFQTDIEAGQVGINVPIPVPL
PFFSFTGSKASFAGDLNFYGKAGVQFFTQIKTVTQQWKESPAQRVSLSMPTSQK
NT seq 1605 nt   +upstreamnt  +downstreamnt
atgctccgcgccgccctcctccgctcaggctccggcctccgccggcctcccatggccgcg
ccgctctccaccgccgccgccgcctcgtggctctccgacagcgcctcgtctccgcctagg
gtgcgcctcctcatcggcggggagttcgtcgagtcgcgggccgacgagcacgtcgacgtc
accaatccggcgacgcaggaggtggtgtcgcggatcccgctcaccaccgccgacgagttc
agggccgccgtggacgccgccaggaccgccttccccgggtggcggaacacgccggtgacc
acgcggcagcgcatcatgctcaagtaccaggagctcatccgggccaacatggataaactg
gcagagaacattacaaccgaacaggggaagacactgaaggatgcttggggcgatgtattc
cgtgggctagaggtggtggaacatgcttgtggaatggggacactgcagatgggtgaatat
gtatcaaatgtttctaacgggattgacacctttagcattagggagccacttggtgtatgt
gctggaatatgtccattcaattttccagctatgatccccctatggatgttcccaatagcg
gtcacttgtggcaatacttttgttctaaagccatcagaaaaagatccaggggctgctatg
atgcttgcggagctagcaatggaggctggtttaccaaagggtgtgttgaacattgttcat
ggtacccatgatgttgtgaacaacatttgtgatgacgaggacatcaaggcagtttccttt
gttggttccaatatagctggtatgcatatatattctagagcatcggcaaaggggaagcgt
gttcagtctaatatgggtgcaaagaatcatgcaattatccttcctgatgctgaccgagat
gccacactgaatgcccttattgctgctggttttggtgctgctgggcaaaggtgtatggca
ttgagcactgctgtttttgttggaggttcagagccatgggaggatgagctagtcaaacgt
gcaagcagccttgtggttaattcaggaatggctagtgatgcagaccttggtccagtgatc
agcaaacaggctaaggaacgtatctgcaaattaatacaaagtggtgctgataatggtgct
cgtgtgctgcttgatggaagagatattgtggttcctaacttcgagaatggtaattttgtt
ggtccaacactccttgctgatgttaaaagtgaaatggaatgttacaaggaggagattttt
ggtccagttcttctcttgatgaaggctgagagcctagatgatgctatccaaattgtgaac
agaaacaaatatggcaatggagcatccatatttacaacatctggtgtgtctgcaaggaaa
tttcaaacagacattgaagctggccaggtgggcatcaacgtgccgattccagtacccctg
ccgttcttctccttcaccggcagcaaagcctcctttgcaggagacttgaatttctacggc
aaggcgggcgtgcagttcttcacccagatcaagacggtcacgcagcagtggaaggagtcg
ccggctcagcgcgtctccctctccatgcccacctcgcagaagtga

DBGET integrated database retrieval system