KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4342616
Entry
4342616           CDS       T01015                                 
Name
(RefSeq) replication protein A 70 kDa DNA-binding subunit isoform X1
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
SSDB
Motif
Pfam: Rep_fac-A_C REPA_OB_2 DUF223
Other DBs
NCBI-GeneID: 4342616
NCBI-ProteinID: XP_015646346
LinkDB
Position
7:complement(4868009..4877915)
AA seq 549 aa
MEYSLLSQINSTRHNWRIKVRVARSWHLSGTSKRRDFTALELILVDEEGVGITACVGENE
IQKFSTSIVEGHAYFLRNFRVSRQTKKLNAVPSTYAIFFTPWTIVEEIPTEISGSLPLYI
FNFVDFEDLDERARHPNGLVDVIGQLTVVHPLVQSNGLNGPSVRRNVELRDLSDRLLEIT
LWAEHATSFEDEFLIETIGKDEPVIIVFAGLNMKLFSGAPSCRSSAATKWYINIDIPEIN
AFRTSLQGRGCEVLLVPSDGAALGAANEADANRKSISELLSLNPHDNNDVRFTCDARIKE
IDVSSGWWYKACSICRKGVKPTLQGFECVNCDNTEPIITPSYKLNVVIEDNTDRAKIFMF
GGMAEQVVRRTAADLVEESSANQLLLPSPLRALIGRRFVFQIVISEQTFRTGQLCFQVRK
VFNPPPIDGQNNGVHATLGNSLSHATLARTSGAQKKCDPTPLMEASGSSSNKASTLQTYG
VTELPTDPKGSATPPPPFAHGAITKTSPQKGNEISEEHGYLCRRTPVGKRSRSTRKELFS
TKKVKASDD
NT seq 1650 nt   +upstreamnt  +downstreamnt
atggagtacagtctgctatcacaaattaattccaccaggcataattggcgtataaaggtc
agagttgctaggtcatggcatctatctggaacttccaaaagaagagattttactgctttg
gaacttatcttggtcgatgaagagggggtaggcattacagcttgtgtgggagaaaatgaa
atacagaagttttcaacgtctatagtggagggacatgcctacttcttacggaatttccgt
gttagtagacagacaaaaaagctcaatgctgtgcctagcacatatgccatcttttttaca
ccatggactattgttgaagagatccctacagagatatctggcagtcttccactctacatt
tttaatttcgtggactttgaggatttggatgaaagggcaaggcatccaaatggtttagta
gatgttattggacaactcacggttgtgcaccctctagtacaaagcaacggtttgaatggg
ccatctgttaggcggaatgtggaattacgagaccttagcgatcggctcttggagatcact
ttatgggctgagcatgcaacttcttttgaagatgagttccttattgaaactattggtaaa
gatgaaccagtcataattgtttttgctggccttaatatgaaactattctcaggtgctcca
agttgccggagcagtgctgccacaaaatggtacattaacattgatattccggagattaat
gcctttcgtacaagcctgcaaggaagaggttgcgaggttcttctcgtacctagtgatggt
gctgcactaggagcggctaacgaggcagatgctaataggaagtctatatccgagctttta
tccttgaatcctcatgacaacaacgatgtacgcttcacttgtgacgcacgtataaaggaa
attgatgtctcaagtggttggtggtataaggcttgcagtatttgtagaaagggtgtgaag
ccaactcttcaaggatttgaatgtgttaactgtgacaacacagagccaataatcacaccc
agctataagttaaatgttgtgattgaggacaacactgaccgtgcaaaaatattcatgttt
ggtggtatggcggagcaagttgtgcgacgaacagctgccgatctagttgaagaaagctca
gccaatcagctcttactgccgtcacccctccgtgctctcattggccgtaggtttgttttc
caaatagttataagtgagcagacctttcggactggacaattgtgctttcaagtaaggaaa
gtgtttaatccacccccaatcgatgggcaaaacaatggtgttcatgccactcttggaaat
agtcttagccatgcaaccttagctagaacgtcaggtgctcaaaagaaatgtgatcctacc
cctttaatggaggcatcggggagtagctccaacaaagcatccaccttgcagacatatggt
gtaactgaactcccaacagatcctaaaggaagcgccactccaccacctccttttgctcat
ggggctatcacaaaaacatcaccacagaaggggaatgagatttctgaagaacatggatat
ttatgccgtagaactccggttgggaaacgatctaggtctactcgcaaggaactattctcc
acgaaaaaagtgaaggcaagtgatgattga

DBGET integrated database retrieval system