KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4343080
Entry
4343080           CDS       T01015                                 
Name
(RefSeq) tyrosine decarboxylase 1
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00350  Tyrosine metabolism
osa00360  Phenylalanine metabolism
osa00380  Tryptophan metabolism
osa00950  Isoquinoline alkaloid biosynthesis
osa00965  Betalain biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00936  Melatonin biosynthesis, plants, tryptophan => serotonin => melatonin
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    4343080
   00360 Phenylalanine metabolism
    4343080
   00380 Tryptophan metabolism
    4343080
  09110 Biosynthesis of other secondary metabolites
   00901 Indole alkaloid biosynthesis
    4343080
   00950 Isoquinoline alkaloid biosynthesis
    4343080
   00965 Betalain biosynthesis
    4343080
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4343080
Enzymes [BR:osa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     4343080
    4.1.1.105  L-tryptophan decarboxylase
     4343080
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   4343080
SSDB
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_5
Other DBs
NCBI-GeneID: 4343080
NCBI-ProteinID: XP_015644906
UniProt: Q7XHL3
LinkDB
Position
7:14667967..14676618
AA seq 497 aa
MEGVGGGGGGEEWLRPMDAEQLRECGHRMVDFVADYYKSIEAFPVLSQVQPGYLKEVLPD
SAPRQPDTLDSLFDDIQQKIIPGVTHWQSPNYFAYYPSNSSTAGFLGEMLSAAFNIVGFS
WITSPAATELEVIVLDWFAKMLQLPSQFLSTALGGGVIQGTASEAVLVALLAARDRALKK
HGKHSLEKLVVYASDQTHSALQKACQIAGIFSENVRVVIADCNKNYAVAPEAVSEALSID
LSSGLIPFFICATVGTTSSSAVDPLPELGQIAKSNDMWFHIDAAYAGSACICPEYRHHLN
GVEEADSFNMNAHKWFLTNFDCSLLWVKDRSFLIQSLSTNPEFLKNKASQANSVVDFKDW
QIPLGRRFRSLKLWMVLRLYGVDNLQSYIRKHIHLAEHFEQLLLSDSRFEVVTPRTFSLV
CFRLVPPTSDHENGRKLNYDMMDGVNSSGKIFLSHTVLSGKFVLRFAVGAPLTEERHVDA
AWKLLRDEATKVLGKMV
NT seq 1494 nt   +upstreamnt  +downstreamnt
atggagggagttggcggcggcggcggcggtgaggagtggctgcggccgatggacgcggag
cagctgcgggagtgcgggcaccggatggtggatttcgtcgccgactactacaaatccatc
gaggccttccccgtcctcagccaagtccagccaggatatctgaaggaagttcttccagat
tcagccccaagacaacctgatactttggattccctttttgatgatattcaacaaaaaata
ataccaggagtaacgcactggcaaagtccaaattattttgcttactatccttcaaatagc
agcactgctggattcctgggggagatgcttagtgctgcctttaacattgttggcttcagt
tggataacctctcctgctgctactgagctagaggttatagtcttagactggtttgcaaaa
atgctccagcttccaagccagtttctgtcaactgctcttggtggaggagtaatacaaggt
actgccagtgaagctgttcttgttgcactattggctgcacgagatagagctttaaagaag
catgggaagcattcccttgaaaagttagtagtttatgcatctgaccagacacattctgct
ctacaaaaggcatgccagattgcaggaattttctcagagaatgttagggttgtaattgct
gattgtaataagaactacgccgttgcccctgaggcagttagtgaggcgctttccatagac
ctgtcatctggtttgataccatttttcatctgtgcaacagtaggtacaacatcatcatca
gctgtggaccccctgcctgaactaggacagatagcaaagtccaatgacatgtggttccat
attgatgccgcatatgctggaagtgcttgtatatgcccagagtaccgacaccacctcaat
ggagtggaagaagctgattcgtttaatatgaatgcccacaaatggttcctcactaacttc
gattgttccttgctatgggttaaggacaggagttttctcatacaatcattgtctacgaat
ccagagtttctcaaaaacaaggcttcccaagctaattcagttgttgatttcaaagattgg
caaattccacttggacgacgctttagatcacttaagctatggatggtcttgagactttat
ggtgtggacaacctacaaagctatatccggaaacacatacatttggctgaacattttgag
caacttttattatctgattcaagatttgaggtagtgactccaaggactttttcacttgtt
tgtttccgacttgtgcctcccacttctgaccatgaaaatggacgtaaattgaattacgat
atgatggatggtgtaaattcaagtggaaagatcttcctatctcacacggttctttcaggt
aagttcgtcttgagatttgcagtaggagcgccacttacagaggagcgacacgtggatgcc
gcttggaagcttctacgagatgaggccaccaaggtcttggggaaaatggtgtag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4344636
Entry
4344636           CDS       T01015                                 
Name
(RefSeq) aromatic-L-amino-acid decarboxylase
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00350  Tyrosine metabolism
osa00360  Phenylalanine metabolism
osa00380  Tryptophan metabolism
osa00950  Isoquinoline alkaloid biosynthesis
osa00965  Betalain biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00936  Melatonin biosynthesis, plants, tryptophan => serotonin => melatonin
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    4344636
   00360 Phenylalanine metabolism
    4344636
   00380 Tryptophan metabolism
    4344636
  09110 Biosynthesis of other secondary metabolites
   00901 Indole alkaloid biosynthesis
    4344636
   00950 Isoquinoline alkaloid biosynthesis
    4344636
   00965 Betalain biosynthesis
    4344636
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4344636
Enzymes [BR:osa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     4344636
    4.1.1.105  L-tryptophan decarboxylase
     4344636
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   4344636
SSDB
Motif
Pfam: Pyridoxal_deC SepSecS
Other DBs
NCBI-GeneID: 4344636
NCBI-ProteinID: XP_015648701
UniProt: Q6ZJK7
Structure
LinkDB
Position
8:2256007..2257904
AA seq 514 aa
MGSLDTNPTAFSAFPAGEGETFQPLNADDVRSYLHKAVDFISDYYKSVESMPVLPNVKPG
YLQDELRASPPTYSAPFDVTMKELRSSVVPGMTHWASPNFFAFFPSTNSAAAIAGDLIAS
AMNTVGFTWQASPAATEMEVLALDWLAQMLNLPTSFMNRTGEGRGTGGGVILGTTSEAML
VTLVAARDAALRRSGSDGVAGLHRLAVYAADQTHSTFFKACRLAGFDPANIRSIPTGAET
DYGLDPARLLEAMQADADAGLVPTYVCATVGTTSSNAVDPVGAVADVAARFAAWVHVDAA
YAGSACICPEFRHHLDGVERVDSISMSPHKWLMTCLDCTCLYVRDTHRLTGSLETNPEYL
KNHASDSGEVTDLKDMQVGVGRRFRGLKLWMVMRTYGVAKLQEHIRSDVAMAKVFEDLVR
GDDRFEVVVPRNFALVCFRIRAGAGAAAATEEDADEANRELMERLNKTGKAYVAHTVVGG
RFVLRFAVGSSLQEEHHVRSAWELIKKTTTEMMN
NT seq 1545 nt   +upstreamnt  +downstreamnt
atgggcagcttggacaccaaccccacggccttctccgccttccccgccggcgagggtgaa
accttccagccgctcaacgccgatgatgtccggtcctacctccacaaggcggtggacttc
atctcggactactacaagtccgtggagtccatgccggtgctgcccaatgtcaagccgggg
tacctgcaggacgagctcagggcctcgccgccgacgtactcggcgccgttcgacgtcacc
atgaaggagctccggagctccgtcgtccccgggatgacgcactgggcgagccccaacttc
ttcgcgtttttcccctccacgaatagtgcggccgccattgccggcgacctcatcgcgtcg
gcgatgaacacggtcgggttcacgtggcaggcgtcgccggcggccaccgagatggaggtg
ctcgcgctggactggctcgcgcagatgctcaacctgccgacgagcttcatgaaccgcacc
ggcgaggggcgtggcaccggcggtggggttattctggggacgaccagcgaggcgatgctc
gtcacgctcgttgccgcgcgcgacgccgcgctgcggcggagcggcagcgacggcgtggcg
ggactccaccggctcgccgtgtacgccgccgaccagacgcactccacgttcttcaaggcg
tgccgcctcgccgggtttgatccggcgaacatccggtcgatccccaccggggccgagacc
gactacggcctcgacccggcgaggctgctggaggcgatgcaggccgacgccgacgccggg
ctggtgcccacctacgtgtgcgccacggtgggcaccacgtcgtccaacgccgtcgacccg
gtgggcgccgtggccgacgtcgcggcgaggttcgccgcgtgggtgcacgtcgacgcggcg
tacgccggcagcgcgtgcatctgcccggagttcaggcaccacctcgacggcgtggagcgc
gtggactccatcagcatgagcccccacaaatggctgatgacctgcctcgactgcacctgc
ctctacgtgcgcgacacccaccgcctcaccggctccctcgagaccaacccggagtacctc
aagaaccacgccagcgactccggcgaggtcaccgacctcaaggacatgcaggtcggcgtc
ggccgccgcttccgggggctcaagctctggatggtcatgcgcacctacggcgtcgccaag
ctgcaggagcacatccggagcgacgtcgccatggccaaggtgttcgaggacctcgtccgc
ggcgacgacaggttcgaggtcgtcgtgccgaggaacttcgctctcgtctgcttcaggatc
agggccggcgccggcgccgccgccgcgacggaggaggacgccgacgaggcgaaccgcgag
ctgatggagcggctgaacaagaccggcaaggcgtacgtggcgcacacggtggtcggcggc
aggttcgtgctgcgcttcgcggtgggctcgtcgctgcaggaagagcatcacgtgcggagc
gcgtgggagctcatcaagaagacgaccaccgagatgatgaactaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4344637
Entry
4344637           CDS       T01015                                 
Name
(RefSeq) aromatic-L-amino-acid decarboxylase
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00350  Tyrosine metabolism
osa00360  Phenylalanine metabolism
osa00380  Tryptophan metabolism
osa00950  Isoquinoline alkaloid biosynthesis
osa00965  Betalain biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00936  Melatonin biosynthesis, plants, tryptophan => serotonin => melatonin
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    4344637
   00360 Phenylalanine metabolism
    4344637
   00380 Tryptophan metabolism
    4344637
  09110 Biosynthesis of other secondary metabolites
   00901 Indole alkaloid biosynthesis
    4344637
   00950 Isoquinoline alkaloid biosynthesis
    4344637
   00965 Betalain biosynthesis
    4344637
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4344637
Enzymes [BR:osa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     4344637
    4.1.1.105  L-tryptophan decarboxylase
     4344637
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   4344637
SSDB
Motif
Pfam: Pyridoxal_deC SepSecS
Other DBs
NCBI-GeneID: 4344637
NCBI-ProteinID: XP_015648768
UniProt: Q0J832 Q6YZ18
LinkDB
Position
8:complement(2268447..2270606)
AA seq 523 aa
MGSLDANPAAAYAAFAADVEPFRPLDADDVRSYLHKAVDFVYDYYKSVESLPVLPGVEPG
YLLRLLQSAPPSSSAPFDIAMKELREAVVPGMTHWASPNFFAFFPATNSAAAIAGELIAS
AMNTVGFTWQAAPAATELEVLALDWLAQLLGLPASFMNRTVAGGRGTGGGVILGTTSEAM
LVTLVAARDAALRRSGSNGVAGITRLTVYAADQTHSTFFKACRLAGFDPANIRSIPTGAE
TDYGLDPARLLEAMQADADAGLVPTYVCATVGTTSSNAVDPVGAVADVAARFAAWVHVDA
AYAGSACICPEFRHHLDGVERVDSISMSPHKWLMTCLDCTCLYVRDTHRLTGSLETNPEY
LKNHASDSGEVTDLKDMQVGVGRRFRGLKLWMVMRTYGAGKLQEHIRSDVAMAKTFEDLV
RGDDRFEVVVPRNFALVCFRIRPRKSGAAIAAGEAEAEKANRELMERLNKTGKAYVAHTV
VGGRFVLRFAVGSSLQEERHVRSAWELIKKTTTEIVADAGEDK
NT seq 1572 nt   +upstreamnt  +downstreamnt
atggggagcttggacgccaacccggccgccgcctacgccgcgttcgccgccgacgtcgag
cccttccgcccgctcgacgccgacgacgtccgctcctacctccacaaggccgtcgacttc
gtctacgactactacaagtcggtggagtcgctcccggtgctccctggcgtcgagccgggc
tacctcctgcggctgctgcagtcggcgccgccgtcgtcgtcggcgccgttcgatattgct
atgaaggagctcagggaggcggttgtccccgggatgacccactgggcgagcccgaatttc
ttcgcgttctttccggcgacgaatagcgccgccgcgatcgccggtgagctcatcgcgtcg
gcgatgaacaccgtcggattcacgtggcaggcggcgccggcggcgaccgagctggaggtg
ctcgcgctggattggctcgcgcagctgctcgggttgccggcgagtttcatgaaccgcacc
gtcgccggtgggcgcggcaccggcgggggcgtcattctggggaccaccagcgaggcgatg
ctcgtcacgctcgtcgccgcgcgcgacgccgcgctgcggcggagcgggtccaatggcgtg
gcgggcatcacgcggctgacggtgtacgccgccgaccagacgcactccacgttcttcaag
gcgtgccgcctcgccgggttcgatccggcgaacatccggtcgatccccaccggggccgag
accgactacggcctcgacccggcgaggctgctggaggcgatgcaggccgacgccgacgcc
gggctggtgcccacctacgtgtgcgccacggtgggaaccacgtcgtccaacgccgtcgac
ccggtgggcgccgtggccgacgtcgcggcgaggttcgcggcgtgggtgcacgtcgacgcg
gcgtacgccggcagcgcgtgcatctgcccggagttccggcaccacctcgacggcgtggag
cgtgtcgactccatcagcatgagcccccacaagtggctgatgacctgcctcgactgcacc
tgcctctacgtccgcgacacccaccgcctcaccggctccctcgagaccaacccggagtac
ctcaagaaccacgccagcgactccggcgaggtcaccgacctcaaggacatgcaggtcggc
gtcggccgccgcttccgggggctcaagctctggatggtcatgcgcacctacggcgccggc
aagctgcaggagcacatccggagcgacgtcgccatggccaagacgttcgaggacctcgtc
cgcggcgacgaccggttcgaggtcgtggtgccgaggaacttcgcgctcgtctgcttcagg
atcaggccgaggaaatccggcgccgccatcgccgccggcgaggcggaggccgagaaggcg
aaccgcgagctgatggagcggctgaacaagaccggaaaggcttacgtggcgcacacggtg
gtcggcggcaggttcgtgctgcgcttcgcggtggggtcgtcgctgcaggaggagcggcac
gtgcgaagcgcgtgggagctcatcaagaagacgaccaccgagatcgtcgccgacgccgga
gaagacaagtag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4348564
Entry
4348564           CDS       T01015                                 
Name
(RefSeq) tyrosine decarboxylase 1
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00350  Tyrosine metabolism
osa00360  Phenylalanine metabolism
osa00380  Tryptophan metabolism
osa00950  Isoquinoline alkaloid biosynthesis
osa00965  Betalain biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00936  Melatonin biosynthesis, plants, tryptophan => serotonin => melatonin
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    4348564
   00360 Phenylalanine metabolism
    4348564
   00380 Tryptophan metabolism
    4348564
  09110 Biosynthesis of other secondary metabolites
   00901 Indole alkaloid biosynthesis
    4348564
   00950 Isoquinoline alkaloid biosynthesis
    4348564
   00965 Betalain biosynthesis
    4348564
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4348564
Enzymes [BR:osa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     4348564
    4.1.1.105  L-tryptophan decarboxylase
     4348564
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   4348564
SSDB
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_5 Aminotran_1_2 DUF3289
Other DBs
NCBI-GeneID: 4348564
NCBI-ProteinID: XP_015613814
UniProt: Q338J0
LinkDB
Position
10:complement(13523613..13525968)
AA seq 515 aa
MGSLPLDALQPLDPDTFAADSSAVVDFLAGYYRDVDKYPVRAADLEPGRLRRLLPEAAPE
FGEPAERILADVRRDVLPGLTHWQSPSFFAYFPMNASAAGFAGEMLSVGLNVVPFMWVAS
PAAVELEAVVVDWMARLVGLPDRFLFSGSGGGGGGGGGGVLQGSTCEAVVCTLAAARDRA
LGRIGHEGIVKLVVYASDQTHATFQKGARLVGITPANFRVVPTAAASGYALTGAAVRAAV
EGDVARGLVPLYLCATVGTTGIGAVDPVRELGEVARRHGMWLHVDAAYAGSAAICPEYQG
YLDGAELADSVSMNPHKWFLTNMDCCCLWVASPAALTAALSTDPEYLKNAGGGKPQAAAG
AGAIDYKDWQISLSRRFRAMKLWFVLRRYGAAGMRAHIRRHVAMAEWFERAVSADERFEV
VAKRRFSLVCFRLRGGGGGGDAMNRELLAAVNASGRAFMTHFVVEGKFVIRLAVGGAMTE
MRHVGDAWELVQRTAEQLLQRRGTRKNEDENPLPW
NT seq 1548 nt   +upstreamnt  +downstreamnt
atgggtagcttgccactcgacgcgctccagccactggacccggacaccttcgccgccgac
tcctccgccgtcgtcgacttcctcgccggctactaccgcgacgtcgacaagtaccccgtc
cgcgccgccgacctcgagcctggccgcctccgcaggctcctcccggaggccgcgccggag
ttcggggagccggcggagcggatcctcgctgacgtgcgccgcgacgtgctcccggggctc
acgcactggcagagccccagcttcttcgcctacttcccgatgaacgccagcgccgccggg
ttcgccggcgagatgctctccgtggggctcaacgtcgtgccgttcatgtgggttgcgtcg
ccggctgccgtggagctggaggccgtcgtggtggactggatggctaggctggtgggcttg
cctgatcgcttcctcttctccggctccggcggcggcggcggcggcggtggcggtggtgtt
ctgcaggggagcacctgcgaggccgtggtgtgcacgctcgccgccgcgcgggaccgcgcg
ctggggaggattgggcacgagggcatcgtgaagctggtggtgtacgcctccgaccagacg
cacgccacgttccagaagggcgcgcggctggtcggcatcacgccggcgaacttccgcgtc
gtcccgacggcggcggcgtcggggtacgcgctgacgggcgccgccgtgcgcgccgcggtg
gagggcgacgtggcgcgcgggctggtcccgctgtacctgtgcgccactgtgggcaccacg
gggatcggcgccgtcgaccccgtccgcgagctcggcgaggtggcgcgccgccacggcatg
tggctccacgtcgacgccgcgtacgccggcagcgcggcgatctgcccggagtaccagggc
tacctcgacggcgccgagctcgccgactcggtgagcatgaacccgcacaagtggttcctc
accaacatggactgctgctgcctctgggtggcgagccccgccgcgctcaccgccgcgctg
tccaccgacccggagtacctcaagaacgccggcggcgggaagccccaggccgccgccggc
gccggcgccatcgactacaaggactggcagatctcgctgtcgcggcggttccgcgccatg
aagctctggttcgtgctgcggcggtacggcgctgcgggcatgcgcgcgcacatccggcgc
cacgtcgccatggccgagtggttcgagcgcgcggtgagcgccgacgagcggttcgaggtg
gtggcgaagaggaggttctccctcgtgtgcttccgcctccgcggcggcggcggcggcggc
gacgcgatgaaccgcgagctcctggcggcggtgaacgcgagcgggcgggcgttcatgacg
cacttcgtggtggagggcaagttcgtgatccggctcgccgtcggcggcgccatgacggag
atgaggcatgtcggcgacgcgtgggagctggtgcagcgcacggcggagcagctgctgcag
cgccgggggacacgtaaaaacgaggatgaaaatccacttccctggtag

DBGET integrated database retrieval system