KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4343286
Entry
4343286           CDS       T01015                                 
Name
(RefSeq) probable (S)-ureidoglycine aminohydrolase
  KO
K14977  (S)-ureidoglycine aminohydrolase [EC:3.5.3.26]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00230  Purine metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    4343286
Enzymes [BR:osa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.26  (S)-ureidoglycine aminohydrolase
     4343286
SSDB
Motif
Pfam: Cupin_2 AraC_binding DUF4437 Cupin_3 Pirin_C
Other DBs
NCBI-GeneID: 4343286
NCBI-ProteinID: XP_015644616
UniProt: Q7F1K9
LinkDB
Position
7:18509982..18515199
AA seq 309 aa
MMLPRLLLLVVASALPLASVAAGAVGVGEGFCSAEPSAASGGCSGVRPPLYWKATNPTLA
PAHLQDLPGFTRSVYKRDHALITPESHVFSPLPDWINTLGAYLISPAIGAHFTMYLAKMH
DGSKSALPPKGVERLIFVLQGSILLSEESGNTHTLLVDSYAYLPANMKHSVISDEVTTLV
IFERRYTTIEGYHPDLIVGSTDKQPLLETPGEVFELRKLLPTSLPYDFNIHIMDFQPGEY
LNVKEVHYNQHGLLLLEGQGIYRLGDSWYPVQSGDTIWMAPFVPQWYAALGKTKTRYLLY
KDVNRDPLI
NT seq 930 nt   +upstreamnt  +downstreamnt
atgatgctcccccggctcctcctcctcgtcgttgcctccgcgctgccgctcgcttccgtc
gctgcgggcgccgtcggcgtcggcgaggggttctgctcggcggagccgtcggcggcgtcg
ggcggctgctccggcgtgcggccgccgctctactggaaggccaccaacccgactctggcg
cccgcgcacctccaggatttacctggcttcacacgtagtgtttacaaaagggatcatgct
ttgattacaccagagagccatgtattcagccctttgcctgactggatcaacacattagga
gcatatttaattagtccagctatcggggcacatttcacaatgtacctggcaaaaatgcat
gatggatcaaaatcagccctaccaccaaaaggtgttgaaaggcttatctttgtactccaa
ggaagcattctattgtctgaggagagtgggaatacccatactctgctggtggactcttat
gcctatcttcctgcaaacatgaaacactctgtgatctcagatgaagtaactacccttgta
atctttgagaggaggtacacaaccattgagggttaccatcctgatctcattgttggatca
actgataagcaaccccttcttgaaaccccaggagaggtatttgagttgaggaagctgcta
cccacttctctgccttatgactttaatatccatataatggattttcagcctggggaatat
cttaatgtgaaggaggttcattacaatcaacatgggttgctgcttttagagggacaagga
atataccgattgggagacagctggtacccggtgcaatcaggggacaccatttggatggca
ccgtttgtgcctcaatggtacgctgcccttggaaaaaccaagacgaggtacttgctgtat
aaagatgtcaatagggatccactgatatga

DBGET integrated database retrieval system