KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4343287
Entry
4343287           CDS       T01015                                 
Name
(RefSeq) putative casein kinase II subunit beta-4 isoform X1
  KO
K03115  casein kinase II subunit beta
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03008  Ribosome biogenesis in eukaryotes
osa04712  Circadian rhythm - plant
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03008 Ribosome biogenesis in eukaryotes
    4343287
 09150 Organismal Systems
  09159 Environmental adaptation
   04712 Circadian rhythm - plant
    4343287
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:osa03009]
    4343287
   03036 Chromosome and associated proteins [BR:osa03036]
    4343287
Ribosome biogenesis [BR:osa03009]
 Eukaryotic type
  90S particles
   Kinase
    4343287
Chromosome and associated proteins [BR:osa03036]
 Eukaryotic type
  Histone modification proteins
   Polycomb group proteins
    AUTS2-polycomb complex
     4343287
SSDB
Motif
Pfam: CK_II_beta
Other DBs
NCBI-GeneID: 4343287
NCBI-ProteinID: XP_015647422
UniProt: Q84RS4 Q0D6B6
LinkDB
Position
7:18519344..18523475
AA seq 288 aa
MYKQGGGGGGGGGGGGGAGLDRKRISDALDKHLEKAVAAAAAAASPSTSRGSAGGRGGGD
HQRLVVPSSASSMPKGRCSEGESESDSEASDVSGSDGEDHSWISWYCSLRGNEFFCEVDD
DYIQDDFNLCGLSSQVPYYDYALDLILDIESSHGDMFTEEQNELVESAAEMLYGLIHARY
ILTSKGLAAMLEKYKNYDFGRCPRVYCCGQPCLPVGQSDIHRSSTVKIYCPKCEDIYYPR
SKYQGNIDGAYFGTTFPHLFLMTYEHLKPQKPSQRYVPRVFGFKLHKP
NT seq 867 nt   +upstreamnt  +downstreamnt
atgtacaagcaggggggaggagggggagggggagggggaggcggaggcggcgcggggctg
gaccggaagcgaatcagcgacgcgctcgacaagcacctcgagaaggcggtcgcggcggcg
gcggcggccgcgtcgccctcgacgtcgagggggtcggcgggggggaggggcggtggtgac
caccagcgcctcgtcgtgccgtcctccgcgtcgtccatgcccaagggacggtgctccgaa
ggggagtctgaatctgatagtgaagcatcagatgttagtggttctgacggagaggatcac
tcatggatttcatggtactgcagtctaagagggaatgaattcttctgtgaggttgatgat
gattatatacaagatgacttcaacctctgtgggcttagcagtcaagttccatattatgat
tatgctcttgatctcattttagatatcgaatcttctcacggtgacatgttcaccgaagaa
caaaacgagctagtggagtcagctgcagagatgttatatgggctgattcatgcacgatac
attttgaccagtaaaggattggctgcaatgctggagaagtacaaaaactatgattttgga
agatgcccacgagtttattgctgtggtcaaccctgtttaccagttggacaatcagatata
caccgatctagtactgtgaagatatactgccccaagtgtgaagacatctactatccacgg
tccaagtaccaaggcaacatcgacggcgcatactttgggacaacattcccgcacctgttt
ctgatgacgtacgagcacctcaagcctcagaaaccctcgcagcgctacgttcctcgtgta
tttggattcaagctccacaagccatga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4349414
Entry
4349414           CDS       T01015                                 
Name
(RefSeq) putative casein kinase II subunit beta-4 isoform X1
  KO
K03115  casein kinase II subunit beta
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03008  Ribosome biogenesis in eukaryotes
osa04712  Circadian rhythm - plant
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03008 Ribosome biogenesis in eukaryotes
    4349414
 09150 Organismal Systems
  09159 Environmental adaptation
   04712 Circadian rhythm - plant
    4349414
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:osa03009]
    4349414
   03036 Chromosome and associated proteins [BR:osa03036]
    4349414
Ribosome biogenesis [BR:osa03009]
 Eukaryotic type
  90S particles
   Kinase
    4349414
Chromosome and associated proteins [BR:osa03036]
 Eukaryotic type
  Histone modification proteins
   Polycomb group proteins
    AUTS2-polycomb complex
     4349414
SSDB
Motif
Pfam: CK_II_beta
Other DBs
NCBI-GeneID: 4349414
NCBI-ProteinID: XP_015614912
UniProt: Q9AY38 A0A5S6R6T5
LinkDB
Position
10:22308894..22313844
AA seq 280 aa
MSGAYRDRGFGGAAAEMDRKRIKDVLEKHLDRSSPSTSRGAAVAKERDRLAAAGGKLPAP
LGKAGKVSDGAEEFETDSEDSDVSGSEGEDTSWISWFCSLRGNEFFCEIDDDYIQDDFNL
CGLSNQVPYYDYALDLILDIESSNGDVFTEEQNELIESSAEMLYGLIHARYILTSKGLAA
MLEKFKNYDFGRCPRVYCCGQPCLPAGQSDIPRSSTVKIYCPKCEDLHYPRSKYQGNIDG
AYFGTTFPHLFLMTYPHLKPQKPSQQYVPKVFGFKLHKQS
NT seq 843 nt   +upstreamnt  +downstreamnt
atgagcggcgcgtacagggatcgggggttcggcggcgcggcggcggagatggaccggaag
cgcatcaaggacgtgctcgagaagcacctggacaggtcgtccccgtccacatccaggggg
gcggcggtggccaaggagagggaccgcctcgccgccgcaggggggaagctgcccgcgccg
ctcggcaaggccgggaaggtctccgatggtgcagaagaatttgaaactgacagtgaagat
tcagatgtcagtggttctgagggagaggacacatcttggatttcatggttctgcagtttg
cgcggcaatgagttcttctgtgagatcgatgatgattatatacaggatgatttcaacctt
tgtggtctgagcaatcaggtgccatattatgactatgcacttgatcttatcttagacatc
gagtcttctaatggtgatgtgttcactgaggagcaaaatgaattaattgagtcatctgca
gagatgctgtatggattaattcatgcaagatatatcttaaccagcaagggtctggctgca
atgttggagaagttcaagaactatgactttggaagatgcccccgggtatactgttgtggc
caaccctgtcttcctgcagggcaatcagatattcctaggtctagcacagtgaagatatac
tgtccaaaatgtgaagatttacattatccaagatccaagtaccaaggcaacattgacgga
gcgtactttgggacaacattcccacatctcttcctgatgacatatccacacttgaagcca
caaaagccatctcagcagtatgttccaaaagtttttggcttcaaacttcacaagcagtca
tga

DBGET integrated database retrieval system