KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4343366
Entry
4343366           CDS       T01015                                 
Name
(RefSeq) ATP synthase subunit gamma, chloroplastic
  KO
K02115  F-type H+-transporting ATPase subunit gamma
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00190  Oxidative phosphorylation
osa00195  Photosynthesis
osa01100  Metabolic pathways
Module
osa_M00157  F-type ATPase, prokaryotes and chloroplasts
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    4343366
   00195 Photosynthesis
    4343366
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:osa00194]
    4343366
Photosynthesis proteins [BR:osa00194]
 Photosystem and electron transport system
  F-type ATPase [OT]
   4343366
SSDB
Motif
Pfam: ATP-synt
Other DBs
NCBI-GeneID: 4343366
NCBI-ProteinID: XP_015646852
UniProt: Q0D641 Q84NW1
LinkDB
Position
7:complement(19656082..19657644)
AA seq 358 aa
MSCSHLSTAWSSSALATRRRSAPSCGSSGRLQVVRCSLRELRSRIDSVRNTQKITEAMKL
VAAAKVRRAQEAVVSSRPFSEALVEVLYNMNQEIQTEDIDLPLTRIRPVKKVALVVLTGE
RGLCGSFNNNVLKKAETRIEELKQLGLEYTVVSVGKKGNAYFIRRPFIPTERTLEVNGIP
TVKDSQSICDLVYSLFVSEAVDKVELLYSKFVSLVRSDPIIQTLLPMSPKGEICDINGVC
VDATEDELFRLTTKEGKLTVEREKVKIETQPFSPVVQFEQDPVQILDALLPLYLNSQILR
ALQESLASELAARMSAMSSATDNAIELRKNLSMVYNRQRQAKITGEILEIVAGADALA
NT seq 1077 nt   +upstreamnt  +downstreamnt
atgtcgtgctcgcacctctccaccgcctggtcctcctccgccctggccacccgccgccgc
tccgctcctagctgcggcagcagcggccgcctgcaggtggtgcggtgctcgctgcgtgag
ctgcggagccgcatcgactcggtgcgcaacacgcagaagatcacggaggcgatgaagctg
gtggcggcggccaaggtgcggcgggcgcaggaggcggtggtgtcctcccgccccttctcg
gaggcgctggtggaggtgctctacaacatgaaccaggagatccagacggaggacatcgac
ctccccctcacccgcatccgccccgtcaagaaggtcgccctcgtcgtcctcaccggcgag
cgcggcctctgcggcagcttcaacaacaacgtcctcaagaaggccgagacccgcatcgag
gagctcaagcagctcggcctcgagtacaccgtcgtcagcgtcggcaagaagggcaacgcc
tacttcatccgccgccccttcatccccaccgagcggacgctggaggtgaacggcatcccc
accgtgaaggactcccagtccatctgcgacctcgtctactcgctgttcgtgtccgaggcg
gtggacaaggtggagctcctctactccaagttcgtctccctcgtccgctccgaccccatc
atccagacgctgctccccatgtcgcccaagggggagatctgcgacatcaacggcgtgtgc
gtggacgccaccgaggacgagctgttccggctcaccaccaaggaagggaagctgaccgtg
gagcgggagaaggtgaagatcgagacgcagcccttctcacccgtggtgcagttcgagcag
gaccccgtccagatcctcgacgcgctcctcccgctctacctcaacagccagatcctccgc
gcgctccaggagtcgctcgccagcgagctcgccgccaggatgagcgccatgagcagcgcc
accgacaacgccatcgagctccggaagaacctctccatggtctacaaccgccagcgccag
gccaagatcaccggcgagatcctcgagatcgtcgccggcgccgacgccctcgcctaa

DBGET integrated database retrieval system