KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4343604
Entry
4343604           CDS       T01015                                 
Name
(RefSeq) chlorophyll a-b binding protein of LHCII type III, chloroplastic
  KO
K08914  light-harvesting complex II chlorophyll a/b binding protein 3
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00196  Photosynthesis - antenna proteins
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09102 Energy metabolism
   00196 Photosynthesis - antenna proteins
    4343604
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:osa00194]
    4343604
Photosynthesis proteins [BR:osa00194]
 Antenna proteins
  Light-harvesting chlorophyll-protein complex (LHC) - Plant, Green alga [OT]
   LHCII
    4343604
SSDB
Motif
Pfam: Chloroa_b-bind
Other DBs
NCBI-GeneID: 4343604
NCBI-ProteinID: XP_015646539
UniProt: Q6ZF30 A3BL59
LinkDB
Position
7:22487424..22488722
AA seq 266 aa
MASTIMAPTSRVLAAKTPFLGHPRPSNAPVRDIAAAATGRITMSKELWYGPDRVKYLGPF
SAQTPSYLRGEFPGDYGWDTAGLSADPEAFARNRALEVIHGRWAMLGALGCITPEVLEKW
VRVDFKEPVWFKAGAQIFSDGGLDYLGNPNLVHAQSILAVLGFQVVLMGLVEGYRINGLP
GVGDGNDLYPGGQYFDPLGLADDPVTFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPL
ENLLDHLADPVANNAWVYATKFTPGS
NT seq 801 nt   +upstreamnt  +downstreamnt
atggcgtccacgatcatggccccaacctcccgcgtcctcgccgccaagacccccttcctc
ggccatccccgcccctccaatgcccccgtccgcgacatcgccgccgccgccaccggccgc
atcaccatgagcaaggagctgtggtacgggccggatagggtgaagtacctggggccattc
tcggcgcagacgccgtcgtacctgaggggcgagttcccgggcgactacgggtgggacacg
gcggggctctccgcggacccggaggcgttcgcgaggaacagggcgctggaggtgatccac
ggccggtgggcgatgctcggcgcgctgggctgcatcacgccggaggtgctcgagaagtgg
gtgcgcgtcgacttcaaggagcccgtgtggttcaaggccggcgcccagatcttctccgac
ggcggcctcgactacctcggcaaccccaacctggtgcacgcccagagcatcctcgccgtg
ctgggattccaggtcgtcctcatgggcctcgtcgagggctaccgcatcaacggcctcccc
ggcgtcggcgacggcaacgacctctaccccggcggccagtacttcgacccgctcggcctc
gccgacgaccccgtcaccttcgccgagctcaaggtcaaggagatcaagaatggccgcctc
gccatgttctccatgttcggcttcttcgtccaggccatcgtcaccggcaagggccccttg
gagaacctgctcgaccacctcgccgaccccgtcgccaacaacgcctgggtctacgccacc
aagttcacgccgggctcgtga

DBGET integrated database retrieval system