KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4343707
Entry
4343707           CDS       T01015                                 
Name
(RefSeq) constitutive photomorphogenesis protein 10
  KO
K20217  ubiquitin-conjugating enzyme E2 E [EC:2.3.2.23]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    4343707
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:osa04121]
    4343707
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.23  E2 ubiquitin-conjugating enzyme
     4343707
Ubiquitin system [BR:osa04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   4343707
SSDB
Motif
Pfam: UQ_con
Other DBs
NCBI-GeneID: 4343707
NCBI-ProteinID: XP_015647158
LinkDB
Position
7:23349398..23352043
AA seq 123 aa
MSSSSSSFPTSRSPFPAGAGAGTSGGGGGGGGGSGGGGGGGRWSGVRPWGSSGGTSVSSS
GKRIQKELMDLNASDCSAGPKGDNLYHWLSTIIGPQGSPYEGGIFFLDIVFPIDYPFKPP
MSG
NT seq 372 nt   +upstreamnt  +downstreamnt
atgtcgtcgtcttcctcctccttcccgacctctcgctcccctttccccgccggcgccggc
gccggcaccagcgggggcggaggaggaggaggagggggctccggcggcggaggtgggggt
ggaagatggagcggcgtgcgcccctggggctccagcggcggcacgtcggtgtcgtcgtcg
gggaagcggattcagaaggagctgatggacctcaacgcctccgactgctccgccggccct
aagggcgacaacctctaccactggctctccaccatcatcggacctcagggatctccgtat
gaaggagggatatttttcctcgatattgtattcccaattgactatccgtttaaacctccc
atgagtggatag

DBGET integrated database retrieval system