KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4343709
Entry
4343709           CDS       T01015                                 
Name
(RefSeq) chlorophyll a-b binding protein 7, chloroplastic
  KO
K08908  light-harvesting complex I chlorophyll a/b binding protein 2
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00196  Photosynthesis - antenna proteins
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09102 Energy metabolism
   00196 Photosynthesis - antenna proteins
    4343709
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:osa00194]
    4343709
Photosynthesis proteins [BR:osa00194]
 Antenna proteins
  Light-harvesting chlorophyll-protein complex (LHC) - Plant, Green alga [OT]
   LHCI
    4343709
SSDB
Motif
Pfam: Chloroa_b-bind
Other DBs
NCBI-GeneID: 4343709
NCBI-ProteinID: XP_015647391
UniProt: Q6ZL95 Q0D569
LinkDB
Position
7:23357688..23359391
AA seq 263 aa
MALVSASSSTTAVAALPGAARASSFLGGAGRSGRLLLRQAESSSARASFAVRAAAPDRPI
WFPGSTPPPWLDGSLPGDFGFDPLGLGSDPESLRWNVQAELVHCRWAMLGAAGIFIPEFL
TKIGILNTPSWYTAGEQQYFTDTTTLFIIELILIGWAEGRRWADIIKPGCVNTDPIFPNN
KLTGTDVGYPGGLWFDPLGWGTGSPEKIKELRTKEIKNGRLAMLAVMGAWFQAEYTGTGP
IDNLFAHLADPGHATIFQAFTPK
NT seq 792 nt   +upstreamnt  +downstreamnt
atggcgctcgtctccgcctcctcctccaccaccgccgtcgcggcgctccccggcgccgcc
agggcctcctccttcctcggcggcgccggcaggagcggcaggctgctgctgaggcaggcc
gagtcgtcgtccgcgcgggcgtcgttcgccgtgcgcgccgcggcgcccgacaggccaatc
tggttccccggcagcaccccgccgccgtggctcgacggcagcctccccggcgacttcggc
ttcgaccccctgggtctcggatcggacccggagagcttgcggtggaacgtgcaggcggag
ctggtgcactgccggtgggcgatgctgggcgcggcgggcatcttcatcccggagttcctg
accaagatcggcatcctcaacacgccgtcgtggtacaccgccggcgagcagcaatacttc
accgacaccaccaccctcttcatcatcgagctcatcctcatcggctgggccgagggccgc
cggtgggctgacatcatcaagcccggctgcgtcaacaccgaccccatcttccccaacaac
aagctcaccggcaccgacgtcgggtaccctggtggtctgtggtttgacccgctcggctgg
ggcaccggctcgccggagaagatcaaggagctgcgcaccaaggagatcaagaacgggcgg
ctcgccatgctcgccgtcatgggagcttggttccaggcagagtacaccggcaccggcccc
atcgacaacctcttcgcccatctcgccgaccccggccacgccaccatcttccaggccttc
acccccaaatga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4347166
Entry
4347166           CDS       T01015                                 
Name
(RefSeq) chlorophyll a-b binding protein, chloroplastic
  KO
K08908  light-harvesting complex I chlorophyll a/b binding protein 2
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00196  Photosynthesis - antenna proteins
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09102 Energy metabolism
   00196 Photosynthesis - antenna proteins
    4347166
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:osa00194]
    4347166
Photosynthesis proteins [BR:osa00194]
 Antenna proteins
  Light-harvesting chlorophyll-protein complex (LHC) - Plant, Green alga [OT]
   LHCI
    4347166
SSDB
Motif
Pfam: Chloroa_b-bind
Other DBs
NCBI-GeneID: 4347166
NCBI-ProteinID: XP_015612359
UniProt: Q0J1H6 Q69P91
LinkDB
Position
9:16287868..16290863
AA seq 264 aa
MALPSGSFAACSIQPRVRAALRAPTLPSQNAAVARMAGHRAGATKGGVSAVCEPLGPDRP
LWFPGSSPPPWLDGSLPGDFGFDPLGLGSDPELLRWFAQAELMHSRWAMLAVAGILVPEV
LEKWGFMEDYSWIDAGARDYFADPWTLFVSQMALMGWAEGRRWADYLNPGCVAVEPRLPN
RRNPVPDVGYPGGLWFDWGNWGRGSPEPVMVLRTKEIKNGRLAMLAFVGFWFQAVYTGEG
PIDNLLHHLADPGHCNVFSAFTSH
NT seq 795 nt   +upstreamnt  +downstreamnt
atggctctgccctccggctcattcgcggcatgtagcatccaaccaagggtgcgggcggcg
ttgcgcgcgccgacgctgccgtcgcagaacgccgccgttgcaaggatggccggccaccgc
gccggcgcgacgaagggcggcgtgtccgcggtgtgcgagccgctggggcccgacaggccg
ctctggttccccggcagctcccctcctccgtggctcgacggcagcctcccgggagacttc
ggtttcgatcctcttggattagggtcggatccggagctgctgcggtggttcgcgcaggcg
gagctgatgcacagccggtgggcgatgctggcggtggcggggatcctggtcccggaggtg
ctggagaaatgggggttcatggaggactactcatggatcgacgccggcgcgcgcgactac
ttcgcggacccgtggacgctgttcgtgtcgcagatggcactgatggggtgggcggagggg
cggcggtgggcggactacctcaaccccgggtgcgtcgccgtcgagccgcggctgcccaac
cggaggaaccccgtgccggacgtcggctaccccggcgggctgtggttcgactggggcaac
tggggccggggatcgccggagcccgtcatggtgctgcgcaccaaggagatcaagaacggg
aggctcgccatgctcgccttcgtggggttctggttccaggccgtctacaccggcgagggc
cccattgataacctcctgcatcacctcgccgaccccggccactgcaacgtcttctcggca
ttcacgtcccattga

DBGET integrated database retrieval system