KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4343871
Entry
4343871           CDS       T01015                                 
Name
(RefSeq) peroxisome biogenesis factor 10
  KO
K13346  peroxin-10
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    4343871
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:osa04121]
    4343871
Ubiquitin system [BR:osa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Peripheral membrane proteins
    4343871
SSDB
Motif
Pfam: Pex2_Pex12 zf-C3HC4_3 zf-RING_2 zf-C3HC4_2 zf-C3HC4 zf-RING_UBOX zf-rbx1 zf-C3HC4_4 zf-RING_5 Prok-RING_4 zf-Nse zf-RING_10 zf-RING_6
Other DBs
NCBI-GeneID: 4343871
NCBI-ProteinID: XP_015647577
UniProt: B9FYC7 Q6YTX9
LinkDB
Position
7:25039205..25043735
AA seq 389 aa
MRGGGGGDAGTSSRGGGSGGAPARPRRFPEAAQPEIMRAAEKDDGYAAHVTEACRDAFRH
LFGTRVAVAYQNEIKLLGQSLYYLLTTGSGQQTLGEEYCDISQVATSHGLPPTPARRILF
ILYQTTVPYLAERISSRIVARGIALEDSQLDDHSESDSSSIGTAAQPSPIRNSPSRSLSF
SHLSRLRGRVHTLWEWVLRKWPSMLPFAQDFIQLTIRTNLMFFYFEGLYYHLPKRAAGIR
YVFIGKPLNQRPRYQILGIFLLIQLCILGAERLRRSNLSTIASSINQISSGGYPSSRGRG
VPVLNEDGNIISDIRHGKTADLATSSEASSGKSKCTLCLSTRQNPTATTCGHVFCWSCIM
EWCNEKPECPLCRTPITHSSLICIYHSDF
NT seq 1170 nt   +upstreamnt  +downstreamnt
atgcgcggcggcggcggcggggatgcgggcaccagctcgaggggcggcggttccggcggg
gcccccgcgcgtccgcggcggttccctgaggcggcgcagccggagatcatgcgggcggcg
gagaaggacgacggctacgccgcgcacgtcaccgaggcctgccgcgacgccttccgccac
ctcttcggtaccagggtcgccgttgcttatcagaacgagataaaattgcttggtcagtct
ctttattacttgctaacaactggttcaggccagcaaacacttggagaagaatactgtgat
atatctcaggttgcaacctcgcacggacttccgcctacacctgctagacggattctattc
attttgtaccaaactaccgttccctatcttgctgaacgcatcagctctagaattgttgca
cgtggtattgccctcgaggactctcagcttgatgaccattctgaaagtgatagttctagt
ataggcactgcagcacaaccatccccaattaggaacagtccttcaagaagcttgagtttt
tctcatttgtcaaggttgagaggcagagtccataccttgtgggaatgggttcttcggaaa
tggccttcgatgctaccatttgctcaagattttatacagttaactatccggacaaacctt
atgttcttctattttgaaggattgtattatcatttaccaaagcgagcagctggcattcgt
tatgtattcattgggaagccattgaatcagaggcccaggtatcaaatcttgggtattttt
ctgttaattcagttatgtattcttggtgctgaaagacttcgaagaagtaatttatcaaca
atagctagttcgattaaccaaatctcatctggaggctatccttcatcaagaggtcgaggt
gtccctgttctaaatgaagatggaaatataatcagcgacatccgccatgggaaaactgca
gatttggctactagttcagaggcatccagtggtaagagcaaatgcaccctttgtctcagt
acccgtcagaatcccactgccacaacctgtggccatgtcttctgctggagttgcattatg
gagtggtgtaatgagaagcctgaatgccccctatgcagaactccgattacacattcgagt
ttgatttgtatatatcattcagatttctag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4343872
Entry
4343872           CDS       T01015                                 
Name
(RefSeq) uncharacterized protein LOC4343872
  KO
K13346  peroxin-10
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    4343872
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:osa04121]
    4343872
Ubiquitin system [BR:osa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Peripheral membrane proteins
    4343872
SSDB
Motif
Pfam: Dabb Cytochrom_B562
Other DBs
NCBI-GeneID: 4343872
NCBI-ProteinID: XP_015646800
UniProt: Q6YTX6 Q6Y3R5
LinkDB
Position
7:25045099..25051606
AA seq 270 aa
MICLRAAFPLTSSFSSSPLRRLALKPSSSRAAAAAAMSSAPATAIAAPVEHIVLIKVRPE
AAASGAAAAMVSSLQALSSVVPGLSYIHVGPVLRLRSPAAEALGPTHVLHSRYATKPDLA
AYAAHPAHVAAVQGHVLPNALDTTAIDWVNAALAPSPVTPGSAVRLTLAKVKEGVEVPQL
VEKVAAATAAAGEAKGARVSFGENFSPARAKGYQFGMVAVFDSVEELDAVEGDGKVQEAK
AAVRPLLDEVLVLDFVVGPAAVEAPAPANL
NT seq 813 nt   +upstreamnt  +downstreamnt
atgatttgcctccgagccgccttccccttgacctcctccttctcctcctcccctctccgc
cgcctcgccctcaagccctcctcctcccgcgccgccgccgccgccgccatgtcgtccgcc
cccgccaccgccatcgccgcgccggtcgagcacatcgtgctcatcaaggtccgccccgag
gcggcggcgtcgggcgccgccgcggcgatggtgtcctcgctgcaggcgctgtccagcgtg
gtgcccgggctgtcgtacatccacgtcggccccgtgctccgcctccggtcgccggcggcg
gaggcgctggggccgacccacgtcctccactcccgctacgccaccaagcccgacctggcg
gcgtacgcggcgcacccggcgcacgtcgccgccgtgcaggggcacgtcctccccaacgcg
ctcgacaccaccgccatcgactgggtcaacgccgcgctcgcgccgtccccggtcaccccg
ggctccgccgtgcggctcacgctggcgaaggtgaaggaaggtgtggaggtgccccagctc
gtggagaaggtcgccgcggcgacggcggcggcgggcgaggcgaagggcgccagggtgagc
ttcggggagaacttctcccccgcgcgggctaaggggtaccagttcgggatggtggcggtg
ttcgacagcgtggaggagctcgacgcggtggagggggacgggaaggtgcaggaggccaag
gcggcggtgaggccactgctcgacgaggtgctcgtgctggacttcgtcgtcggacctgcc
gccgtggaggctccggcgccggccaacctctga

DBGET integrated database retrieval system