KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4343875
Entry
4343875           CDS       T01015                                 
Name
(RefSeq) glutamic acid-rich protein
  KO
K03024  DNA-directed RNA polymerase III subunit RPC7
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03020  RNA polymerase
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    4343875
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:osa03021]
    4343875
Transcription machinery [BR:osa03021]
 Eukaryotic type
  RNA polymerase III system
   RNA polymerase III
    Pol III specific subunits
     4343875
SSDB
Motif
Pfam: RNA_pol_3_Rpc31
Other DBs
NCBI-GeneID: 4343875
NCBI-ProteinID: XP_015645529
UniProt: B9FU68 Q7XB88
LinkDB
Position
7:25192280..25194950
AA seq 206 aa
MASRGRGRGRGRRGGGYGFDHPAKHTPHEDFPDITLPEMTCARATMEEKALIQSTLKFED
FWKTSCYHLEEDVPKKKNDDKEIERYSDRKRKTHSKREALASYLILTPANFPVELVQGSK
RGQPSSKKLRWDRSSDDQAFEVFEKLEEKHKDGDKKTEKDGDDEDEHEEEEVEEENSDDD
YNQNIEFDDDDDDWNQEEEAHEDYYD
NT seq 621 nt   +upstreamnt  +downstreamnt
atggcgtcccggggccgcgggagaggccgggggaggcggggaggagggtacggcttcgac
cacccggccaagcacaccccccacgaggatttcccggacatcaccctgccggagatgacg
tgcgccagggcgaccatggaggagaaggctctgatacagtccaccttgaaatttgaggat
ttctggaagacttcttgctaccacctggaggaggatgtccccaagaaaaagaatgatgat
aaagagattgaaaggtattctgataggaaacgtaagacacattccaaacgtgaagctctt
gcgtcatatcttatactaactcctgcaaatttccctgtggaactagtgcaaggttctaag
cgaggacagccaagcagtaagaagctgcgttgggatagaagctcagatgatcaggcattt
gaagtttttgagaagcttgaagagaagcacaaggacggagacaagaaaacagaaaaggat
ggggatgatgaggatgaacatgaagaggaagaagtagaagaggagaattcagatgatgat
tataatcagaatatcgagtttgatgacgacgatgatgactggaaccaagaggaggaagca
catgaagactactatgattag

DBGET integrated database retrieval system