KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4343909
Entry
4343909           CDS       T01015                                 
Name
(RefSeq) 40S ribosomal protein Sa-2
  KO
K02998  small subunit ribosomal protein SAe
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4343909
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4343909
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Small subunit
    4343909
SSDB
Motif
Pfam: Ribosomal_S2 40S_SA_C DUF92
Other DBs
NCBI-GeneID: 4343909
NCBI-ProteinID: XP_015647072
UniProt: Q0D4N2 Q8H3I3
LinkDB
Position
7:complement(25413440..25415693)
AA seq 305 aa
MAAEGGAAARALSQREQDIQMMLAADVHLGTKNCDFQMERYVYKRRTDGIYIINLGKTWE
KLQLAARVIVAIENPQDIIVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSF
SEPRLLILTDPRTDHQPIKESALGNIPTIAFCDTDSPMRYVDIGIPANNKGKQSIGCLFW
LLARMVLQMRGTILPGHKWDVMVDLFFYRDPEEAKEQEEEEAALVAPDYGAVAEYAAPAA
DTWGGEWGTDAAAQPAAIPAQAGADWTAAPAPAAGGWDTAAAPAPGWEQGSAPVPAAAPT
PNWGE
NT seq 918 nt   +upstreamnt  +downstreamnt
atggcggcggaaggcggtgccgccgctcgggcgctgtcccagcgggagcaggacatccag
atgatgctcgccgcggacgtccacctcggcaccaagaactgcgacttccagatggagcgc
tacgtctacaagcgccgcactgacggtatctacattattaaccttggcaagacctgggag
aagctccagttggctgcgagggtcattgttgcaattgaaaaccctcaggacatcattgtg
cagtctgcgaggccctatggccagagggctgttctcaagtttgctcagtacactggtgct
cacgccattgctggtaggcacactcctggtacatttaccaaccagctgcagacctcattc
agtgagccacgccttcttatcctgactgaccccaggactgatcatcagccaattaaggag
tctgcacttggaaacattcctaccattgccttctgtgacactgactctccaatgcgctat
gttgatattggtattcctgctaacaacaaggggaagcagagcattggttgcctattctgg
cttcttgccaggatggttctccagatgcgtggtacaattctcccaggacacaagtgggat
gtcatggttgatctgttcttctacagggacccagaggaagcgaaggagcaagaggaagaa
gaggcggctctggtggctcctgattatggtgcggttgcggaatatgctgccccagcggct
gatacctggggtggagaatggggcactgacgctgcagctcaacctgctgccattccagca
caggctggtgctgactggactgctgctccagctcctgcagccggaggatgggacacggct
gctgcccctgcccctggatgggaacaaggcagtgcaccagtcccagcggcagcacccacc
cctaactggggggagtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9272225
Entry
9272225           CDS       T01015                                 
Name
(RefSeq) 40S ribosomal protein SA
  KO
K02998  small subunit ribosomal protein SAe
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    9272225
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    9272225
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Small subunit
    9272225
SSDB
Motif
Pfam: Ribosomal_S2 40S_SA_C
Other DBs
NCBI-GeneID: 9272225
NCBI-ProteinID: XP_015630616
UniProt: Q10QU9 A0A8J8XJZ0
LinkDB
Position
3:complement(4336753..4338943)
AA seq 305 aa
MAAVAGGAARALSQAEQDVQMMLAADVHLGTKNCDFQMERYVYKRRSDGIYIINLGKTWE
KLQLAARVIVAIENPQDIIVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSF
SEPRLLILTDPRTDHQPIKESALGNIPTIAFCDTDSPMRYVDIGIPANNKGRNSIGCLFW
LLARMVLQMRGTILPGHKWDVMVDLFFYRDPEEAKEQEEEAPAQDFAAITDYTAPEQWSA
DQWTSDVAAPPAATVGDWGAAPAPVAAAEGWDQAGAPVATEAAVVPPVAPTGWDPAAQPA
AQGWD
NT seq 918 nt   +upstreamnt  +downstreamnt
atggcggcagtggcaggaggcgcagcgcgggcgctgtcgcaggcggagcaggacgtgcag
atgatgctcgccgccgacgtccacctcggcaccaagaactgcgacttccagatggagcgc
tacgtctacaagcgccgctccgatggtatctacatcatcaacctcggcaagacatgggag
aagctgcagctcgcggcgagggtgattgttgccattgagaacccccaggacatcattgtc
cagtcggcccgcccctacggccagcgcgccgtcctcaagttcgcgcagtacactggcgcg
cacgccattgctggaaggcatacgcctggtacatttaccaatcagctccagacctccttc
agcgagccccgtctgctcatcctcactgacccaaggaccgatcaccagccaatcaaggag
tctgctctgggaaacatcccgaccattgccttctgtgacaccgattccccaatgcggtat
gtcgatatcggcatcccggccaacaacaaggggaggaacagcattgggtgcctgttctgg
ctcttggctaggatggttctgcagatgaggggtactatcctccctggccacaagtgggat
gttatggttgatctgtttttctacagagaccctgaggaggccaaggagcaggaggaggaa
gctccagcacaagactttgctgccatcactgattacaccgcacctgaacaatggtctgct
gaccagtggacctctgatgtggctgctcccccagctgctactgttggtgattggggcgca
gctccagctccagttgctgctgccgaaggatgggatcaagcaggagcacccgtagccact
gaagccgccgtcgttccaccggttgcgcctactggatgggacccggcagctcaaccagct
gctcaaggctgggattag

DBGET integrated database retrieval system