KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4343975
Entry
4343975           CDS       T01015                                 
Name
(RefSeq) 4-alpha-glucanotransferase DPE1, chloroplastic/amyloplastic
  KO
K00705  4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00500  Starch and sucrose metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    4343975
Enzymes [BR:osa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     4343975
SSDB
Motif
Pfam: Glyco_hydro_77
Other DBs
NCBI-GeneID: 4343975
NCBI-ProteinID: XP_015645120
UniProt: Q8LI30 F2ZBU6
LinkDB
Position
7:25980430..25984856
AA seq 594 aa
MATLSLPLPHLTQAIPARARPRPRPLRGIPARLLSCRAAMAVAPDKEEAAAVALDKAVKV
AVAAPDRAAVAAVGVGEELPEGYDQMMPAVEEARRRRAGVLLHPTSLRGPHGIGDLGDEA
VAFLAWLRDAGCTLWQVLPLVPPGRKSGEDGSPYSGQDANCGNTLLISLEELVKDGLLME
NELPDPLDMEYVEFDTVANLKEPLIAKAAERLLLSRGELRTQYDCFKKNPNISGWLEDAA
LFAAIDRSIDALSWYEWPEPLKNRHLRALEDIYQKQKDFIEIFMAQQFLFQRQWQRIRKY
AKKLGISIMGDMPIYVGYHSADVWANRKSFLLDKNGFPTFVSGVPPDAFSETGQLWNSPL
YDWKAMEAGGFEWWIKRINRALDLYDEFRIDHFRGLAGFWAVPSESKVALVGSWRAGPRN
AFFDALFKAVGRINIIAEDLGVITEDVVDLRKSIEAPGMAVLQFAFGGGSDNPHLPHNHE
FDQVVYTGTHDNDTVIGWWQTLPEEEKQTVFKYLPEANRTEISWALITAALSSVARTSMV
TMQDILGLDSSARMNTPATQKGNWRWRMPSSVSFDSLSPEAAKLKELLGLYNRL
NT seq 1785 nt   +upstreamnt  +downstreamnt
atggctaccctctccctccctctcccgcatctcacccaggccatccccgcgcgagcgcgt
ccgcgaccgcgaccgctccgtgggatccccgcgcggctcctctcctgccgcgccgcgatg
gcggtggcgcccgacaaggaggaggcggcggcggttgctctggacaaggcggtgaaggtg
gcggtggcagctcccgacagggcggcggtggccgcggtgggcgtcggggaggagctcccc
gaggggtacgaccagatgatgccggccgtggaggaggcgcggcggcggcgagccggggtg
ctgctgcacccgacctcgctccgcggcccgcacggcatcggcgacctcggcgacgaggcg
gtcgccttcctcgcctggctccgcgacgccggctgcacgctctggcaggttcttccgctt
gttccaccgggaaggaagtctggggaggatggctctccatattcaggacaggatgcaaac
tgtggtaataccctattaatttcacttgaagagcttgtaaaagatgggttgttgatggag
aatgaactacctgaccccttggatatggagtatgttgaatttgacaccgttgccaatctg
aaagaacctcttattgcaaaggctgcagagaggctcctactgagccgtggagagctcaga
acgcaatatgactgcttcaagaaaaatccaaatatttcaggttggcttgaagatgctgca
ctttttgctgctattgacagaagtattgatgcattatcctggtatgagtggcctgaacct
ctgaaaaaccgacatctcagggccttggaagacatatatcaaaaacagaaggatttcata
gagatatttatggctcaacaattcttatttcaaaggcagtggcagcgaattcgtaaatat
gcaaagaagttgggtatcagcataatgggtgacatgcccatatatgttggctaccatagt
gcagatgtttgggcaaacaggaaatcgtttttgctggacaagaatggttttccgactttt
gttagtggtgttccacctgatgcatttagtgaaactggtcagctttggaacagtccattg
tacgactggaaagctatggaagcaggtggatttgaatggtggataaaaaggattaatcgt
gcccttgatttgtatgatgagttccgtatagaccatttccgggggcttgcaggtttttgg
gcagttccttctgagtcaaaagtagcgctggttggaagctggagggctggaccgaggaat
gcattttttgatgcattattcaaagctgtcggtagaataaacataatagcagaagacctg
ggggtgataacagaagatgttgttgacctaaggaagtctattgaggctcctggaatggca
gttcttcagtttgcttttggcggtggttctgacaatccacacttgccccataaccatgaa
tttgatcaagtagtatacaccggaacacacgacaatgacacggttattggttggtggcaa
actttaccagaggaagagaagcagactgtgttcaagtatctgcctgaggctaataggact
gaaatctcatgggcactgatcactgctgccctctcttcagttgcaaggacatccatggta
accatgcaggacattcttggcctcgacagttctgctagaatgaatactccagctacacag
aaagggaactggagatggaggatgccgagctctgtcagcttcgacagcctcagccctgaa
gcggcgaagctgaaggaattgcttggactgtacaaccggctctaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4344192
Entry
4344192           CDS       T01015                                 
Name
(RefSeq) 4-alpha-glucanotransferase DPE2
  KO
K00705  4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00500  Starch and sucrose metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    4344192
Enzymes [BR:osa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     4344192
SSDB
Motif
Pfam: Glyco_hydro_77 CBM_20
Other DBs
NCBI-GeneID: 4344192
NCBI-ProteinID: XP_015647212
UniProt: Q69Q02 A0A1B0SZS5
LinkDB
Position
7:27960445..27968000
AA seq 946 aa
MTNLSGKKSLNTVTLVFKLPYYTQWGQSLLIAGSEPALGSWNVKQGLSLSPVHQGNELIW
SGRVSVATGFTCQYNYYVVDDNKNVLRSESGEKRKLVLPEGVQDGDVVEIRDWWQDASEA
LFLRSAFKNVIFNGSENAKRELKTTSLNKSLEPEDIVVQFIVSCPRLGAGSTVVVTGSNP
QLGRWQTQDGLKLNYVGDSIWKANCLLRKSEFPIKYKYCKISEAGVSSLEFGPNREADVD
LSSPKPSRYVLLSDGALRESPWRGAGVAVPIFSIRSNEDLGVGEFLDLKLLVDWAVNSGF
HLVQLLPINDTSVHGMWWDSYPYSSLSVFALHPLYLRVQALSDAIPGDIKDEISQAKKQL
DKKDVDYEASLASKLSIARKIFKLEKDKVLNSSSFKQFLSENEEWLKPYAAFCFLRDFFE
TSDHSQWGRFSQFSKEKLDKLVSEGTLHHDVICFHYYIQYHLYMQLSEAAAYARKKKVIL
KGDLPIGVDRNSVDTWVYPTLFRMNTATGAPPDYFDKNGQNWGFPTYNWEEMSKDNYGWW
RARLTQMAKYFTAYRIDHILGFFRIWELPDHAATGLVGKFRPSIALSQEELLSEGLWDFD
RMSRPYILQETLEEKFGSFWTVIAANFLNEYKKQHYEFKEDCNTEKKIIAKLKNSSEKSL
WLEKEDSIRRGLFDLLQNIVLIRDPEDSTKFYPRFNQEDTSSFNDLDEHSKNILRRLYYD
YYFARQENLWRQNALKTLPVLLNSSDMLACGEDLGLIPACVHPVMQELGLIGLRIQRMPS
EPNLEFGIPSQYSYMTVCAPSCHDCSTLRAWWEEDGGRRSRFYQTVIGSDDEPPSRCTPE
VANFIVKQHFDAPSMWAIFPLQDLLALKDKYTTRPAKEETINDPTNPKHYWRFRLHVTLD
SLLDDKDIQATIKELVTSSGRSFPGKVDGAEESGEKLAKVQLNGKP
NT seq 2841 nt   +upstreamnt  +downstreamnt
atgacgaatttgtccgggaagaaatctctgaatacagtgaccttggtcttcaaattaccc
tactacacacaatgggggcagagtcttctcatcgccggctcagagccagcacttggatct
tggaatgttaagcaaggattgtctctcagtccagttcatcagggaaatgagctaatctgg
tccggcagagtttccgtcgctactggttttacctgccagtacaattactatgtagtggac
gacaacaagaatgttttgagatcggagtccggggagaaaaggaaattagtacttccagag
ggtgttcaggatggagatgtagttgagatacgcgactggtggcaggatgcttctgaagct
cttttccttcgaagtgcattcaagaatgtcattttcaatgggtctgaaaatgctaaaaga
gaattgaagactacatccctcaacaaaagtttggagcctgaagatattgttgttcagttt
attgttagctgtccccgacttggagctggctctactgtcgtggtcacaggaagtaatcct
caattaggaaggtggcaaacacaagatggcctcaagcttaattatgtcggagattccatc
tggaaagcaaactgtctgttgcgaaagtctgagttcccaataaaatataaatactgtaaa
attagtgaagcaggagtctcttcattggagttcggtccgaacagggaggctgatgtggat
ctatcatcacccaagccatccagatacgtcctcttgtctgatggtgcccttcgggaatca
ccatggaggggtgcaggtgttgctgtacctatattctcgatcaggtcaaatgaggacctt
ggtgttggagaattccttgatcttaaacttcttgttgactgggcagtcaactcaggcttt
catcttgttcagcttcttcctatcaatgatacttcagttcacgggatgtggtgggattca
tacccatacagctcgctctctgtgtttgcattgcaccccttgtacctgagagtacaagca
ctttcagatgcaattccaggggatattaaggacgagatttcacaggcaaagaagcagttg
gacaaaaaggatgttgactatgaggcatcactggcctcaaaactctcgatagcaagaaaa
atattcaaattagagaaagacaaagtactaaattccagttcgttcaagcagtttttatct
gaaaacgaggagtggttgaaaccatatgctgcattttgttttctgcgggacttctttgag
acatcagatcacagccaatggggccgtttttctcagttttccaaggagaagctagataag
cttgtttctgaaggtaccttgcaccatgacgttatatgtttccattactacatccagtac
catctatatatgcaattatcagaggcagctgcctatgcaaggaagaaaaaggttattctg
aaaggagatttacctattggtgttgataggaatagtgtggatacttgggtataccccact
ttatttcgcatgaatacagctactggtgcacctccagattatttcgacaaaaatggacaa
aattggggttttcctacatataactgggaggaaatgtcaaaggataattatgggtggtgg
cgagctcgtctgacacagatggcaaaatacttcactgcatataggatagaccatatcttg
ggtttctttaggatatgggagcttccagatcatgcagccacaggtctagttgggaaattt
aggccttcaattgctctcagtcaggaggagcttcttagtgaaggcctatgggatttcgat
agaatgagccgcccttatattcttcaggaaacactggaggagaagtttgggtccttttgg
acagtaattgcagctaactttctaaatgagtacaagaaacaacattacgagttcaaagag
gactgcaatacagagaaaaagataattgcaaagcttaagaacagttctgaaaaatcatta
tggctggagaaagaagacagcattcggcgtggtttgtttgatctactacagaatatagtc
cttattagagatccagaggacagcacaaaattttatccccgcttcaaccaggaggatact
tcaagttttaacgatctagatgaacatagcaaaaatatcctcagaagattgtactatgac
tattattttgctcgccaagagaatctctggcgtcaaaatgcgctcaagactctgcctgtg
cttttgaactcatcggatatgttggcatgtggggaagatcttggccttatccctgcctgt
gttcaccctgttatgcaagaacttggattgattggattgcgtatccagagaatgcccagt
gaaccaaacttggaatttggtattccatctcagtatagctacatgacggtttgtgctccg
tcatgtcatgattgctccacattacgtgcttggtgggaagaagatggaggaagaagaagc
cgtttctaccagactgtaattggtagtgatgacgagccgccatctcgctgcaccccagaa
gtagcgaactttattgttaagcagcattttgatgctccatcaatgtgggcaatcttccca
ctacaggacctgcttgcacttaaagacaagtacaccacaagaccagcaaaagaggaaaca
atcaatgacccaactaacccgaagcattattggagattccggctacatgtgacattggat
tcgctgttggacgataaggacatccaagcaaccatcaaggaacttgtcacaagtagtggg
aggtcatttcctggtaaggtggatggcgccgaagaaagcggagagaagctagctaaagtc
cagttgaatggtaaaccatag

DBGET integrated database retrieval system